KEGG   Brevibacterium flavum ZL-1: C628_03835Help
Entry
C628_03835        CDS       T04445                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
bfv  Brevibacterium flavum ZL-1
Brite
KEGG Orthology (KO) [BR:bfv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    C628_03835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ANR61753
LinkDB All DBs
Position
815921..817006
Genome map
AA seq 361 aa AA seqDB search
MSTRTTPQDRYTDEYGIERVNKDEPGLVDKLRDKHDWFDHLMRMNERFGAKGGNQLSAGI
TYFSVLSIFPIAMLVFGIAGVILAGNPEVLTDIQNRINDALEGEIGNTVNGIIDSAIAQR
GAVLGIGGVTALWSGLGWMANLRFGVSRMWAIDPTEGNFIQKKLTDLVALIVLLLAMGVA
FGITALGASGLTKNLLDFVGLGEIPGISYITWVVAALVGVLANFLVFMWLIFSLPRTKVP
MKPGLQAALLGAIGFEVVKQVGSLLASNALSNPAGAAFGPIIGIMVVLYLIWRILMYCSA
WAATSEEALRLATVPAPEPAIIRVRHEIDPGEEVSQSARKVGIGVAVGAATAGAFALLRK
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtctactagaacaacgccacaagaccgttataccgacgaatacggcatcgaacgcgtc
aacaaggatgaacccggcctggtggacaaactccgggacaagcacgactggtttgatcat
ctcatgcgcatgaatgaacgtttcggcgcaaaaggtggcaaccaattgtcggcgggtatt
acgtatttctccgtgctgtctatcttcccgattgccatgcttgtcttcggtattgcaggt
gtcatccttgccggaaatcctgaagttctcacagatattcaaaatcgaatcaacgatgct
ttagaaggcgagatcggtaacaccgtcaacggcatcattgattccgcgattgcgcagcgt
ggtgctgtgttgggcattggtggtgtaactgccctgtggtctggactggggtggatggcg
aacctgcgctttggagtttcccgcatgtgggccattgacccaactgaaggcaacttcatt
caaaagaagctcaccgacctggtcgcgctgatcgtcttgctgctggccatgggcgtagcc
ttcggtatcacggcgctcggtgcttccggactaaccaaaaacctgctggactttgtggga
ctgggggagattccgggcattagctacatcacctgggtggtcgcagcacttgttggtgtc
ttggctaacttcctggtgttcatgtggctgattttctccctgccacgtaccaaagttccc
atgaaaccgggtcttcaagcagcactgcttggcgcaatcggttttgaggtggtcaagcag
gttggatcgctgttggcttcaaatgcattgagtaatcccgcgggtgcagcattcggtccg
atcatcggcatcatggttgtgctgtatttgatctggcgcatcctcatgtattgctctgcg
tgggctgccaccagtgaagaagcgttgcgtcttgcgactgttccagcaccagagcctgcg
atcattcgggttcgccatgaaattgatccaggtgaagaagtctcccaatctgctcgaaaa
gtgggcattggagtggccgtgggtgccgcgactgcgggtgcttttgcgctgttgcgtaaa
aaatag

DBGET integrated database retrieval system