KEGG   Brevibacterium flavum ZL-1: C628_09185Help
Entry
C628_09185        CDS       T04445                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bfv  Brevibacterium flavum ZL-1
Pathway
bfv00010  Glycolysis / Gluconeogenesis
bfv00520  Amino sugar and nucleotide sugar metabolism
bfv01100  Metabolic pathways
bfv01110  Biosynthesis of secondary metabolites
bfv01120  Microbial metabolism in diverse environments
bfv01130  Biosynthesis of antibiotics
bfv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C628_09185
   00520 Amino sugar and nucleotide sugar metabolism
    C628_09185
Enzymes [BR:bfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     C628_09185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ANR62773
LinkDB All DBs
Position
1965296..1966048
Genome map
AA seq 250 aa AA seqDB search
MTETGFGIDIGGSGIKGARVNLKTGEFIDERIKIATPKPATPEAVAEVVAEIISQAEWEG
PVGITLPSVVRGQIALSAANIDKSWIGTDVHELFDRHLNGREITVLNDADAAGIAEATFG
NPAAREGAVILLTLGTGIGSAFLVDGQLFPNTELGHMIVDGEEAEHLAAAAVKENEDLSW
KKWAKHLNKVLSEYEKLFSPSVFIIGGGISRKHEKWLPLLELDTDIVPAELRNRAGIVGA
AMAVNQHLTP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactgagactggatttggaattgatatcggtggctccggcatcaaaggcgcccgcgtt
aaccttaagaccggtgagtttattgatgaacgcataaaaatcgccaccccgaagccagca
accccagaggctgtcgccgaagtagtcgcagagattatttctcaagccgaatgggagggt
ccggtcggaattaccctgccgtctgtcgttcgcgggcagatcgcgctatccgcagccaac
attgacaagtcctggatcggcaccgatgtgcacgaactttttgaccgccacctaaatggc
cgagagatcaccgttctcaatgacgcagacgccgccggcatcgccgaagcaacctttggc
aaccctgccgcacgcgaaggcgcagtcatcctgctgacccttggtacaggtattggatcc
gcattccttgtggatggccaactgttccccaacacagaactcggtcacatgatcgttgac
ggcgaggaagcagaacaccttgcagcagcagccgtcaaagaaaacgaagatctgtcatgg
aagaaatgggcgaagcacctgaacaaggtgctgagcgaatacgagaaacttttctcccca
tccgtcttcatcatcggtggcggaatttccagaaagcacgaaaagtggcttccattgctg
gaactagacactgacattgtcccagctgagctgcgcaatcgagccggaatcgtaggagct
gccatggcagtaaaccaacacctcaccccataa

DBGET integrated database retrieval system