KEGG   Brevibacterium flavum ZL-1: C628_10500Help
Entry
C628_10500        CDS       T04445                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bfv  Brevibacterium flavum ZL-1
Brite
KEGG Orthology (KO) [BR:bfv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bfv01001]
    C628_10500
Enzymes [BR:bfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     C628_10500
Protein kinases [BR:bfv01001]
 Serine/threonine kinases: Other
  Bacterial family
   C628_10500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr Pkinase_fungal APH Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-ProteinID: ANR63028
LinkDB All DBs
Position
2256176..2258269
Genome map
AA seq 697 aa AA seqDB search
MALKVMEEDFVDDPIFRQRFRREARSMAQLNHPNLVNVYDFSATDGLVYLVMELITGGTL
RELLAERGPMPPHAAVGVMRGVLTGLAAAHRAGMVHRDIKPDNVLINSDHQVKLSDFGLV
RAAHAGQSQDNQIVGTVAYLSPEQVEGGEIGPASDVYSAGIVLFELLTGTTPFSGEDDLD
HAYARLTEVVPAPSSLIDGVPSLIDELVATATSINPEDRFDDSGEFLSALEDVAAELSLP
AFRVPVPVNSAANRANAQVPDAQPTDMFTTHIPKTPEPDHTAIIPVASANETSILPAQNM
AQNPLQPPEPDFAPEPPPDTALNIQDQELARADEPEINTVSNRSKLKLTLWSIFVVAVIA
AVAVGGWWFGSGRYGEIPQVLGMDEVQAVAVVEEAGFVAVAEPQYDNEVPTGSIIGTEPS
FGERLPRGEDVSVLVSQGRPVVPDLSEDRSLSTVREELEQRTFVWVDGPGEYSDDVPEGQ
VVSFTPSSGTQLDVGETVQIHLSRGPAPVEIPDVSGMGVDQATRVLERAGLSVERTEEGF
DAETPNGDVYGTSPKVSTEVKRGTSVVLQVSNAISVPDVVGMTKDEATAALAEEGLVVAS
TSIIPGETASSADTVVTVEPESGSRVDPAHPQVSLGLAGEIQVPSVVGRKVSDARSILEE
AGLTLTTDADDNDRIYSQTPRARSEVSVGGEVTVRAF
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttaaagtcatggaagaagatttcgttgatgatcccattttccggcagcgtttc
cgtagggaagctcggtcaatggcgcagctaaatcatccaaatttggtcaatgtgtatgat
ttttccgctactgacggtttggtgtatctggtgatggagttaatcactggcggcaccttg
cgtgagttgctggctgagcggggacctatgcccccgcatgctgctgtgggcgttatgcgt
ggggtgctcacgggtctcgcagctgcccaccgggcgggcatggtgcaccgggatatcaag
cctgacaacgtgttgatcaatagtgatcaccaggtgaaactgtctgatttcggtttggtt
cgagcggctcacgccggccagtctcaggacaatcagattgtgggcacggtggcttatctt
tcccctgagcaggttgagggcggtgagatcgggccggccagcgacgtgtattcggcaggc
attgtgctctttgagctgctcacaggcaccacgcctttttcgggcgaggatgatctcgac
catgcatacgcccgccttacggaagtcgtgccggcaccgagttcgcttatcgacggcgtc
ccctccctcatcgatgagcttgtcgcgacggctacctccattaatcctgaggatcgtttc
gatgattctggagagtttttgtccgcactggaagatgtggcagcagagttgagcttgccg
gctttccgggtccctgtgccggttaattccgcagccaatagggctaatgcccaggtcccg
gatgctcagccaactgatatgtttaccacccatatccccaagactcctgagcctgatcac
actgcgatcattccggtggcctcagcaaatgagacgtcgattctgcctgcgcaaaacatg
gcgcagaatccgctgcaacctccggaacctgatttcgccccggagccacctccggacaca
gcgctgaatattcaagatcaagagcttgcgcgcgccgatgagccagaaattaataccgtc
agcaatcgttccaaattgaagctgacgttgtggtcaattttcgtggtcgcagtgatcgct
gctgttgctgttggcggttggtggttcggttcaggccgttacggtgagattccgcaggtg
ttgggcatggatgaggtccaagcggtcgctgttgtagaggaagctggtttcgtggcagtg
gctgaacctcagtatgacaatgaggttcccactggttcgattattgggactgaaccttct
tttggtgagcgccttcctcgcggcgaggatgtttctgtcctcgtctctcaagggcgtccc
gtggtgccggatcttagcgaggatcgatccttaagcaccgttcgtgaagagttggagcag
cgcacgttcgtctgggttgatggcccaggtgaatattctgacgatgttccagaaggacaa
gtagtttcttttacgccgtcgtctggcacgcagcttgatgttggtgaaaccgtgcaaatc
catttgagccgaggccccgccccggttgagatccctgatgtctctggcatgggagtggat
caggcaacacgtgtgttggagcgcgcaggcttgagcgtcgagcgcactgaggaaggcttt
gatgctgagacaccaaacggtgatgtctacgggacttcgcccaaggtatctactgaggtc
aagcgcggaacctctgttgtgctgcaggtgtccaatgctatttcggtaccggatgtggtg
ggcatgaccaaggacgaagccaccgcggcgcttgcggaagaaggattggtcgtggcgtcg
acaagcattattcctggtgagacggcgagctccgctgacaccgtcgtgaccgtcgagcct
gaatccggcagccgcgttgatccagcgcatccgcaggtcagcctcgggttagctggggag
attcaagttccaagcgtggttggacgtaaggttagcgatgctcgaagcattctggaagaa
gccggtttaacgctgacaactgatgcggacgacaacgatcgaatttatagtcaaacccct
cgtgcacgcagcgaagtctcggtagggggcgaagttacagtaagggcattttag

DBGET integrated database retrieval system