KEGG   Brevibacterium flavum ZL-1: C628_12950Help
Entry
C628_12950        CDS       T04445                                 

Definition
(GenBank) hypothetical protein
Organism
bfv  Brevibacterium flavum ZL-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ANR63489
LinkDB All DBs
Position
complement(2779387..2780478)
Genome map
AA seq 363 aa AA seqDB search
MTVAEFTETTTNAKIITAAVTTSKQTIEFQNLLAPTIVPGSARISMAAVTLCGTDAHIWD
DDYASELPIIQGHEAAGIITEMDPFDEGNGFSVGDRVVICPMFYCGKCYACSVGRVNACK
EMSVYGCYEDGSLVDEQAVPYANLFKIPDSLPLDLAPIVEPISIAMQACKRGRPVSGEKV
IVNGAGPIGVLAVRYLKDQGCEVAVTDMVQSRLDLAKHCGADKTFVVDGGFPNAAQAVEV
DSWTDGNGPSLIIDATGVPASLAAAIDLVATAGRVVCVGISDRDLVFDMRKLVSKEIDLL
GSRNSQNLFPESIALLDKHQDTLRALVTHRFDFENLDEAFTTLTTQNAGVGKIAIDFPGA
QNV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcgcagaattcaccgaaaccactaccaacgcaaagatcatcacggctgctgtt
actacttcgaagcagaccatcgagtttcagaatcttctagcgccgacgattgtgcctggt
tctgcacgaatctccatggcagcggtcacactgtgtggcactgacgcccatatttgggat
gatgattacgcttcagaactccctattattcagggacacgaagcagcaggcattatcact
gagatggatcctttcgatgaaggcaatggattcagtgttggcgatcgagttgtaatttgc
cccatgttctactgcggcaagtgctacgcatgttcggttggtcgtgtgaatgcttgtaag
gaaatgagcgtttacggctgctacgaagatggttctttggttgatgagcaggctgttcct
tacgcgaacctgtttaagattccagattcccttcctcttgatttggcgccgatcgtagag
ccaatctcgattgcgatgcaggcctgcaagcgtggccgtccagtgagtggcgagaaggtt
atcgtcaacggtgctggcccgatcggtgtgctggcggttcgttacctgaaggatcagggc
tgcgaagtcgctgtgaccgatatggtgcagtcccgcttggatctggctaagcactgcggt
gcggacaagactttcgtggttgacggcggttttccgaacgccgcgcaggcagtcgaagtc
gacagctggactgacggaaacggtccatccctgatcattgatgcaactggcgttccagca
tccctggccgcggcgattgatctggtagcaaccgcaggccgcgtggtgtgcgtgggtatc
tctgaccgcgatctggttttcgatatgcgcaagctggtatccaaggagatcgatctcttg
ggttctcgcaactcccaaaacctgttcccagagagcattgcgctgctggataagcaccag
gacaccctgcgcgcattggttacccaccgttttgattttgagaatctcgatgaggcgttc
accacgttgaccacacaaaatgctggtgttggaaagatcgccattgatttcccaggagct
caaaatgtctaa

DBGET integrated database retrieval system