KEGG   Blastomonas fulva: B5J99_04225Help
Entry
B5J99_04225       CDS       T05612                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bfw  Blastomonas fulva
Pathway
bfw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bfw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B5J99_04225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bfw02000]
    B5J99_04225
Enzymes [BR:bfw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     B5J99_04225
Transporters [BR:bfw02000]
 Other Transporters
  Pores ion channels [TC:1]
   B5J99_04225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_N_4 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ASR50779
UniProt: A0A222WW31
LinkDB All DBs
Position
888927..889571
Genome map
AA seq 214 aa AA seqDB search
MSSLIFYTNPWSRGQIARWMLEEAGAAYEQHIVEYGPQMKGAAYRAINPMGKVPAIVHNG
KVVTECAAICAYLAEAFPEAGLAPLPDERADYYRWMFFGAGPLEQAIINHSMGWESPEDK
QAMLGYGTYQLAADTLADWLEDRDYICGERFTAADVYVGAQVDWGQAFGTLPALPAFAAY
ADRLRARPAYQRAKAVDNALIEAAKAAVSEGASA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcctgattttctataccaacccatggtcgcgcggacagatcgcgcggtggatg
cttgaggaagcaggggcggcgtacgagcagcacatcgtcgaatacgggcctcagatgaag
ggtgcggcgtatcgcgccatcaacccgatgggcaaggttcccgcgatcgtccataatggc
aaggtcgtcaccgagtgcgccgcgatctgtgcgtatctggcagaggcctttcccgaagca
gggctcgccccgctgccggacgaacgcgccgattattatcgctggatgttctttggcgcc
ggtccgctcgaacaggcgatcatcaaccattcgatgggctgggaaagtcccgaggacaag
caggcgatgctgggttacggcacctatcagctggcggcggacacgctggcagactggctg
gaagaccgcgattacatctgcggcgagcgcttcaccgcggcggatgtctatgtcggggcg
caggtcgactggggccaggcctttggcacgctgcctgctctgcctgcgtttgccgcttat
gccgaccggctgcgggcccgcccggcctatcagcgcgccaaggcggtcgacaatgcgctg
atcgaggcggccaaggcggccgtgagcgaaggcgcttcggcatga

DBGET integrated database retrieval system