KEGG   Blastomonas fulva: B5J99_07940Help
Entry
B5J99_07940       CDS       T05612                                 

Definition
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
bfw  Blastomonas fulva
Brite
KEGG Orthology (KO) [BR:bfw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B5J99_07940
Enzymes [BR:bfw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     B5J99_07940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: ASR51403
UniProt: A0A222X054
LinkDB All DBs
Position
1690671..1692812
Genome map
AA seq 713 aa AA seqDB search
MHSLSEIRKYTQAAFICAAFLLLSLQACSSPKSAAPGAVDQARLLNASSEPDNWLAGGGG
FDEQHYSALDQINAQNVARLGLAWSFEVDTNRGQEATPLVIDGVMYTSTAWSKVYAIDAR
TGKQLWQFDPQVPGDAAYSTCCDVVNRGVAVWRGKVFVGTIDGRLIAIDARTGDQLWSVQ
TFDRSHPYAITGAPRVFKDKVIIGNGGAEFGVRGYVTAYDTQTGAQLWRFYTVPGDPSKG
PDGAASDSVMPMATRTWAGKWYTMGGGGTAWDSIVYDPEFDQVYIGVGNGAPWNRQVRSD
GKGDNLFLSSIVAVDADTGKYKWHYQQIPGESWDFTATQPMMLATLSIGGKPRRVLMQAP
KNGFFYVLDRKTGKLLSAKAFVPQTWADHIDLATGRPVMSENAYYQNGAKVMSPASVGGH
NWQPMSYSPRTGLVYIPTVRWSMRYDQDPAFKFRPGAELNQGAAISLDPAAPWGTGALIA
WDPLRQREVWRVPQPEMINGGTIATAGDLVFAGDAHGTFSAFGARDGKRLWSFKQPSGIL
AAPASYSIDGVQYIAVLVGKGGGAMGLPDVNRPRIPRLNGRMLVFKLGGKAVLPRVDLDL
PPANPPGQTFSPATVALGGRLYGDKCARCHEGVAAPDLRRSNALSDAETWKAVVYDGVLT
DTGMIGFSKLMSQAQVEAIRAYVGDLALELQKEAKTAPGKGATAKDMARAKPQ
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgcattctctgtcggaaatccggaaatacacgcaggcggcattcatttgtgccgcgttc
ttgctgttgagcttgcaggcgtgttcatcgcccaaatccgcagccccaggtgccgttgat
caggcgagacttctcaatgcttcatccgagccggacaactggctcgcaggtggcggcggg
ttcgatgagcagcattacagtgcgctcgaccagatcaacgcacagaatgttgcacgattg
ggtctcgcatggtcgtttgaagtcgataccaatcgaggacaggaagcgacccctttggtc
attgacggcgtcatgtacacgtcaacggcttggtcgaaggtctatgctatcgatgcacgt
acgggcaagcagctgtggcagttcgatccacaggttcccggtgatgcagcctacagcacc
tgctgcgatgtggtgaatcgcggcgtggctgtctggagggggaaggtttttgtcggtacg
atcgatgggcggctgatcgcgatcgatgcgaggaccggcgatcagctttggtccgtacag
accttcgaccgctcccatccctacgcgattaccggcgccccccgggtcttcaaggacaag
gtcatcattggcaatggcggtgccgaattcggcgtccgcgggtatgtcactgcttatgat
acccaaaccggtgcgcagttatggcgtttctacactgtgccaggcgatccgtcgaaaggg
cccgacggtgccgcatcagattcggtgatgccaatggcgaccagaacctgggcgggcaag
tggtacacgatggggggcggcggcaccgcctgggactcgatcgtttatgatcccgaattc
gaccaggtctatatcggcgtgggcaacggtgcaccgtggaaccggcaggtccgctcggac
ggcaagggtgataacctgttcctgtcctcgatcgtcgcggtcgatgcggacaccggcaag
tacaaatggcattatcagcagatacctggtgaaagctgggacttcaccgcgacccagccg
atgatgctggccacgctttcgatcggcggaaaaccgcgcagggtgctgatgcaggcgccg
aaaaacggcttcttctatgttctcgatcgaaagaccggcaagctgctctctgccaaggca
ttcgtcccgcagacctgggccgaccatatcgatttggcaactgggcgtccggtcatgagc
gagaatgcctattaccagaatggcgcgaaagtcatgtccccggcttcggtcggcggccac
aactggcagcccatgtcctacagcccccgcaccgggctggtgtacattcccaccgtccgc
tggagcatgcgatatgaccaggaccctgcgttcaagttccgtcccggcgctgaactgaac
caaggggcagcgatcagcctcgatcctgctgcaccttggggcaccggcgcattgattgcc
tgggatccgctcagacagcgcgaagtctggcgggtcccacaacccgagatgatcaacggc
ggcacgatcgcgacggcaggcgatctggtgtttgccggcgatgcgcatggcacgttcagc
gcatttggagcaagggacggcaagaggctgtggtcgttcaagcagccatcgggcatcctc
gcagcgccagccagctacagcatcgatggcgttcaatatattgcggtgttggtcggaaag
ggcggtggtgccatgggcctgccggatgtcaatcgtccccggattccgaggcttaacggc
cggatgctggtgttcaagctgggcggaaaggccgtgctgccccgggtcgatctcgatctt
ccgccagccaatccgcccgggcagacattctccccggccactgtcgccttgggcgggcgg
ctgtatggcgataagtgcgcgcggtgccatgagggggtcgcggcgcctgatctgcgtcgc
tccaacgcgctgtccgatgcggaaacgtggaaggccgtcgtttacgatggcgtgctgacc
gacaccggtatgatcggcttttcaaagctgatgtcgcaggcgcaggtcgaagcaatccgg
gcttatgtcggcgatctggcgctcgaacttcagaaggaagcgaagacagcacccggcaag
ggggcaactgccaaggatatggcacgcgcaaaaccgcaatag

DBGET integrated database retrieval system