KEGG   Blastomonas fulva: B5J99_09600Help
Entry
B5J99_09600       CDS       T05612                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bfw  Blastomonas fulva
Pathway
bfw00020  Citrate cycle (TCA cycle)
bfw00190  Oxidative phosphorylation
bfw00650  Butanoate metabolism
bfw01100  Metabolic pathways
bfw01110  Biosynthesis of secondary metabolites
bfw01120  Microbial metabolism in diverse environments
bfw01130  Biosynthesis of antibiotics
bfw01200  Carbon metabolism
Module
bfw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bfw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B5J99_09600
   00650 Butanoate metabolism
    B5J99_09600
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B5J99_09600
Enzymes [BR:bfw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B5J99_09600
    1.3.5.4  fumarate reductase (quinol)
     B5J99_09600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer2
Motif
Other DBs
NCBI-ProteinID: ASR51683
UniProt: A0A222X0Y1
LinkDB All DBs
Position
complement(2050386..2051168)
Genome map
AA seq 260 aa AA seqDB search
MATFTLPANSKITGKGQAFQAKTGGRTKKFKVYRYDPDSGENPRYDTFDIDLDDCGPMVL
DALIKMKSEQDSTLTFRRSCREGICGSCSMNINGRNGLACTTAIEDCKGEVRITPLPHMD
VIKDLVPDFSHFYAQYASIRPWLQTVTPVPSGKERLQSPADRAKLDGLYECILCACCSTS
CPSYWWNSDKFLGPAILLQAYRWLADSRDEMTGERLDELEDPFRLYRCHTIMNCANVCPK
GLNPARAIAEIKKMQVERHV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggctacctttacgcttccggcgaacagcaagatcactggcaagggccaggcgtttcag
gcgaagaccgggggccggaccaagaaattcaaggtctatcgctatgatcccgacagcggc
gagaacccgcgttacgacacgttcgacatcgatctggacgattgcggcccgatggtgctc
gacgcgctgatcaagatgaagtccgagcaggactcgacgctgaccttccgccgctcgtgc
cgggaggggatctgcggctcgtgctcgatgaacatcaacggccgcaatggcctggcctgc
accaccgcgatcgaggattgcaagggcgaggtgcgcatcaccccgctgccgcacatggac
gtgatcaaggatctggtccccgatttcagccatttctacgcgcagtatgcctcgatccgc
ccctggctgcagaccgtgacgccggtgccctcgggcaaggagcggctgcagtcgcccgcc
gaccgcgccaagctcgacggcctttacgagtgcatcctgtgcgcgtgctgctcgaccagc
tgcccgagctactggtggaactcggacaagttcctgggccccgccatcctgctgcaggcc
tatcgctggctcgccgacagccgcgacgagatgaccggtgagcggctcgacgagctggaa
gatcccttccgcctctatcggtgccacacgatcatgaactgcgccaacgtctgccccaag
ggcctcaaccccgcgcgcgcgatcgccgagatcaagaagatgcaggtcgaacggcacgtc
tga

DBGET integrated database retrieval system