KEGG   Blastomonas fulva: B5J99_09615Help
Entry
B5J99_09615       CDS       T05612                                 

Definition
(GenBank) phosphoribosylglycinamide synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bfw  Blastomonas fulva
Pathway
bfw00473  D-Alanine metabolism
bfw00550  Peptidoglycan biosynthesis
bfw01100  Metabolic pathways
bfw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bfw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B5J99_09615
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B5J99_09615
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B5J99_09615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bfw01011]
    B5J99_09615
Enzymes [BR:bfw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B5J99_09615
Peptidoglycan biosynthesis and degradation proteins [BR:bfw01011]
 Precursor biosynthesis
  Amino acid ligase
   B5J99_09615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ASR51685
UniProt: A0A222X084
LinkDB All DBs
Position
complement(2051942..2052949)
Genome map
AA seq 335 aa AA seqDB search
MTQYPAPLTIDAKTRETLKVLFLAKHALGDGSLHPEDGNHAVYHNEVRTILEGLFDNLQV
GNQYAMLFDPPEVDFVFSLLNRGGFVNSEMLVPLLCNRRNLPYLGGSPILRGLSDDKHLS
KLVARARGLPTADWAIYRKGGPVDEKLCPMAERMVIKPNASSASWGVRDAGDWAGVRDAV
AAIHEEGHDAIVEPFLTGSDVEVPVVTIHGKPVILPMMLFEQADPTHLRTYWEKRDLVER
ASKYELVDFDGSPFEAAIAGHTANLAQEFVPFDYGRYEFRLDQDKGELNFLEVNLNCNLW
SQKVFGRSAVRAGWTQEQLIETIVAESLRSHGLMG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaataccctgccccgctcaccatcgatgccaagacgcgcgaaacgctgaaggtc
ctgttcctcgccaagcatgcgctgggcgatggctcgctacaccccgaggacggcaaccac
gcggtctaccacaacgaggtgcgcaccatcctggaagggctattcgacaacctgcaggtg
ggcaaccagtacgcgatgctgttcgatccgcctgaggtcgactttgtcttctcgctgctc
aaccgcggcgggttcgtcaattccgagatgctggtgcccttgctttgcaaccgcaggaac
ctgccctatctcggcggcagcccgatcctgcgcggcctgtccgatgacaagcatctctcc
aagctggtggcgcgcgcgcgcggcctgccgacggcggactgggcgatctatcgcaagggc
ggcccggtcgacgagaagctctgcccgatggccgagcgcatggtgatcaagcccaacgcc
tcgtcggcgagctggggcgtgcgcgacgcgggcgactgggccggcgtgcgcgacgcggtg
gccgcgatccacgaggaaggccatgacgcgatcgtcgagccgttccttaccggcagcgat
gtcgaggtgccggtggtgaccatccacggcaaacccgtgatcctgccgatgatgctgttc
gagcaggccgatccgacccatctgcgcacctattgggaaaagcgcgatctggtcgaacgt
gccagcaagtacgaactggtcgacttcgatggttcgcccttcgaggccgccatcgccggg
cacaccgccaacctcgcgcaggagttcgtgccgttcgactatggccgctacgagtttcgg
ctggaccaggacaagggcgaactcaacttcctcgaggtcaacctcaactgcaacctgtgg
tcgcaaaaggtcttcggccgctccgccgtccgcgccggatggacccaggaacagctgatc
gagacgatcgtcgcagagagcctgcggagccatgggctgatggggtaa

DBGET integrated database retrieval system