KEGG   Blastomonas fulva: B5J99_18610Help
Entry
B5J99_18610       CDS       T05612                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bfw  Blastomonas fulva
Pathway
bfw00620  Pyruvate metabolism
bfw00680  Methane metabolism
bfw01100  Metabolic pathways
bfw01120  Microbial metabolism in diverse environments
bfw01200  Carbon metabolism
Module
bfw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B5J99_18610
  09102 Energy metabolism
   00680 Methane metabolism
    B5J99_18610
Enzymes [BR:bfw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B5J99_18610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ASR53220
UniProt: A0A222X304
LinkDB All DBs
Position
3960098..3962800
Genome map
AA seq 900 aa AA seqDB search
MADIDTTPPAPISQNPDIRYLGRILGDVIRAYGGEKLFRQTEYIRSASVDRHRGVAGADG
IDTGLDSLNLDDTLAFVRGFMLFSMLANLAEDRQGVAQETGATVAEAVERLREHGIGDAA
ITDLLEHSLIVPVLTAHPTEVRRKSMIDHKNRVADLMKMKDAGLDHTPSGDRIDEALHRQ
IALLWQTRPLRRDRLFVADEVENARAYMQDVFLPALPMLYARWERVLGHRPPAFLRLGSW
IGGDRDGNPFVTADALRHALGRQCETALVHYLDGVHALGQDLSIATGLSNTPDAVLALAE
ASGDTSPSRADEPYRRALAGIYARLCATHIRLTGKQPPRPSMLSGEAYASPSELRHDLAV
LANGLASDGAGILASGGALGRLIRAVEIFGFHLATLDLRQNSDVHERVVAELLKAAGVCA
DYAALDEAARVALLRAELGHGRLLINRWHDYSEETAKEIAIVEAAAQAHVDYGPQAITAY
NISKAESVSDMLEVNLLLKEAGLYRPGGDAGAAPQAAIMAVPLFETIGDLEAAPQVMRAY
FALPEIAGLVKARGYQEVMVGYSDSNKDGGYLTSTWSLNHASRALAKVFVDTGIAMQLFH
GRGGAVGRGGGSSFAAIRAQPKGTVQGRIRITEQGEVIAAKYGTVESAELNLEAITSAAL
IATLDHDDLSEADEARFAAAMDMISRDAFRSYRDLVYGTEGFNQFFRAATPITEIAGLKI
GSRPASRSKSQRIEDLRAIPWVFSWAQARIMLPGWYGVGQALQGHADKGLLTAMAQGWPF
FQALLGNMEMVLAKSDMGIARHYAGLVPDEKLREQVFGSITSGWNAAHDNLLSITGQSRL
LADNPALDASIRLRLPYIEPLNLLQIELIKRHRAGEADERIPEGIQLSINAIATALRNSG
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcagacatagacaccaccccgcccgcccccatcagccagaaccccgatatccgctat
cttggccggatcttgggcgacgtcatccgcgcctatggcggcgagaagctgttccgccag
accgaatacatccgctcggccagcgtcgaccggcaccgcggcgttgccggcgccgatggc
atcgacaccggtctcgattcgctcaatctcgacgacacgctcgcctttgtgcgcggattc
atgctgttttctatgctcgccaatctcgccgaggaccggcagggcgtggcgcaggagacc
ggtgcaaccgtggcagaagcggtcgagcggctgcgcgaacatggcatcggcgatgccgcg
atcaccgacctgctcgagcacagcctgatcgttccggtgctcaccgcgcaccccaccgaa
gtgcggcgcaagtcgatgatcgaccacaagaaccgcgttgccgatctgatgaagatgaag
gatgcggggctcgaccacacccccagcggcgaccgaatcgacgaggcgctgcaccgccag
atcgctctgctgtggcagacccgtccgctgcgccgcgaccggctgttcgtcgccgacgag
gtggagaatgcccgcgcctacatgcaggacgtgttcctccccgcgctgccgatgctctat
gcccgctgggagcgcgtgctgggccaccgcccgcccgcgttcctgcggctgggcagctgg
atcggcggcgaccgcgacggcaacccgttcgtcaccgccgatgcgctgcgccatgcgctg
gggcggcagtgcgagaccgcgctggtgcattatctcgacggcgtccacgcgctcggccag
gacctttcgatcgccaccgggctttcgaacacccccgatgcggtgctggcgctggcggaa
gccagcggcgacacctcgcccagccgcgccgacgaaccttatcgccgcgcgcttgcagga
atctatgcgcggctgtgcgccacgcatatccgcctcaccggcaagcagccgccgcgcccc
tctatgctgtcgggcgaggcctatgccagcccttccgagctgcggcacgatctggcggtg
ctcgccaacgggcttgccagcgatggcgctggaatcctggcgagtggcggcgcgctagga
cggctgatccgcgcggttgaaatcttcggcttccacctcgccacgctcgacctcaggcag
aacagcgacgtccacgagcgcgtggtggcagagctgctcaaggccgcaggcgtgtgcgcc
gattacgccgcgctggacgaggcggcccgcgtcgcgttgctgcgcgccgagctcggccat
ggccgcctgctgatcaaccgctggcacgattacagcgaggagaccgccaaggagatcgcg
atcgtcgaggccgccgcccaggcgcatgtcgattacgggccgcaggcgatcaccgcgtac
aacatcagcaaggccgaaagcgtgtccgacatgctcgaagtcaacctgctgctcaaggag
gctgggctctaccgccccggcggcgatgccggggccgccccgcaggctgctatcatggcg
gtgcccttgttcgagacgatcggcgatctcgaagccgcaccgcaggtgatgcgcgcttat
ttcgcgcttcccgaaatcgcaggcctggtgaaggcgcgcggctatcaggaggtgatggtc
ggctattcggatagcaacaaggacggcggctatctcacctcgacctggagcctcaaccac
gccagccgcgcgctcgccaaggtgttcgtcgacaccgggatcgcgatgcaattgttccac
ggccgcgggggtgctgtcgggcgcggcggcggatcgagctttgccgcgatccgcgcgcag
cccaaggggacggtgcagggccgcatccgcatcaccgaacagggcgaggtcatcgccgcg
aaatacggcacggtcgaaagcgcggagctcaacctcgaggctatcacctcggccgccctg
atcgcgacgctcgaccatgatgatctgagcgaagccgatgaggcgcgctttgccgccgcg
atggacatgatctcgcgcgatgccttccgcagctatcgcgacctggtctacggcaccgag
gggttcaaccagttcttccgcgccgccaccccgatcacagagatcgccgggctcaagatc
ggctcgcgtccggcaagccgctccaagagccagcggatcgaggatctgcgcgctataccc
tgggtgttcagctgggcgcaggcgcgaatcatgctgccgggctggtatggcgttggccag
gcgctgcaggggcatgccgacaagggcctgctcaccgcgatggcgcagggctggccgttc
ttccaggcgctgctcgggaatatggagatggtgctggccaagtccgacatggggattgcg
cgccattatgccgggctggtccccgacgaaaagctgcgcgagcaggtcttcggttcgatc
acatcgggctggaacgcagcgcacgacaatctgctgagcatcaccggtcagtcgcgactg
ctcgcagacaatcctgcgctagatgcctcgatccggctgcggctgccctatatcgagccg
ctcaacctgctgcagatagagctgatcaagcgccaccgcgcgggcgaggccgacgagcgt
attcccgagggcatccagctgtcgatcaacgcaattgccaccgcgctgcgcaacagcggc
tga

DBGET integrated database retrieval system