KEGG   Bacillus flexus: BC359_00530Help
Entry
BC359_00530       CDS       T04803                                 

Definition
(GenBank) Hsp33 family molecular chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
bfx  Bacillus flexus
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bfx03110]
    BC359_00530
Chaperones and folding catalysts [BR:bfx03110]
 Heat shock proteins
  HSP33
   BC359_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 Elf1
Motif
Other DBs
NCBI-ProteinID: AQX52940
LinkDB All DBs
Position
complement(93904..94782)
Genome map
AA seq 292 aa AA seqDB search
MSDYLVKALAYNNQVRAYAVKTTEAVGEAQRRHYTWPTASAALGRAMSAGVMMGAMLKGE
QKLTIKVEGGGPIGAILVDSNAKGEVRGYVTNPQTHFELNKHGKLDVARAVGTGGTLSVV
KDVGMRDQFNGQVPIVSGELGEDFTYYFVTSEQVPSSVGVGVLVNPDNTILAAGGFIIQL
LPGTDEATISAIEQRLQTIEPISKLIQRGLTPEEILEEVLGKDNLKILETMPVEFKCQCS
KERIGNAIISLGKDEIQSMIDEDGKAEAQCHFCNEMYHFPAEELKEMKEEAI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactacttagtcaaggctttagcatataataatcaagttcgtgcctacgctgtg
aaaacaacggaggcagtaggtgaagcgcagcgtcgccattatacatggccaacagcttca
gctgcattaggacgtgcgatgagtgccggtgtaatgatgggtgcgatgttaaagggagag
cagaagttaacaataaaagtcgaaggtggcggaccgattggcgcaatccttgtggatagc
aatgccaaaggggaagttcgtggttatgttacaaatccacaaacacattttgaattaaac
aaacacggtaaattagatgtcgctcgtgcagtaggtacgggaggcacgcttagtgtcgta
aaagacgttggaatgagagatcaatttaatggtcaggtaccgattgtatcaggtgaatta
ggagaagatttcacgtattattttgtaacatctgaacaagttccttcatcagttggcgtt
ggtgtgttagtaaaccctgataacaccatcttggctgcaggaggcttcattattcagctg
ttaccaggaacagatgaagcgacaatctcagcaattgaacagcgcttgcaaaccattgaa
cctatctctaagcttattcaacgtggattaacaccagaagaaattcttgaagaagttcta
ggaaaagataaccttaaaattcttgaaaccatgcctgtggaatttaaatgtcaatgttct
aaagagcgcattggtaatgcaattattagcttaggaaaagatgaaattcaatcaatgatt
gatgaagatggcaaagctgaagcgcaatgtcacttctgtaatgaaatgtatcactttcct
gcagaagagctaaaagaaatgaaagaagaagctatataa

DBGET integrated database retrieval system