KEGG   Bacillus flexus: BC359_01515Help
Entry
BC359_01515       CDS       T04803                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bfx  Bacillus flexus
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BC359_01515
Enzymes [BR:bfx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BC359_01515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like GIDA DAO FAD_binding_3 AlaDh_PNT_C Thi4 NAD_binding_7 Thioredoxin_4 K_oxygenase NAD_binding_8 FMO-like Glutaredoxin Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AQX53098
UniProt: A0A4P8X420
LinkDB All DBs
Position
complement(287270..288799)
Genome map
AA seq 509 aa AA seqDB search
MLLDANIKAQLDQYLQLLESDIVLKVSAGEDKVSRDMLSLVDELATMSSRIKVEKAELER
TPSFSVNRIGEDTGVTFAGVPLGHEFTSLVLALLQVSGRAPKVDQKVIDQIKNIKGEYKF
ESYISLSCHNCPDVVQALNLMSILNNGISHTMIDGAAYKEEVESKDIMAVPTVYLNGEEF
GSGRMTIEEILNKLGSGPDAAEFADKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKKTEGPKLVASLEEHVKDYGIDVMNLVRARSLKKKDLVELELD
NGAVLKSKTVILSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFEGKRVAVIGGGNSGV
EAAIDLAGIVNHVTVFEYMSELKADAVLQERLNSLPNVTVVKNAQTKEITGTDKVNGITY
IDRETEEEKHVELEGVFVQIGLVPNTDWLGDDVERTRMGEIVVDKHGATNIPGVFAAGDC
TDSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttattagatgcaaatatcaaagcacagctagatcagtatcttcaattattagaaagt
gacattgtgctaaaagtaagcgcgggagaagataaagtatcccgcgacatgctttcatta
gtagatgaactagcaacaatgtcatctcgcattaaagttgaaaaagctgaattagagcgt
acaccgagctttagcgtaaatcgtatcggtgaagatacaggtgtaacatttgccggcgtc
cctttaggacatgagtttacttcattagttcttgctttattacaagtaagtggacgtgca
ccaaaagttgatcaaaaagtgattgaccagattaagaacattaagggcgaatacaaattt
gagtcttatatcagcttaagctgccataactgcccagatgttgtacaagctctaaactta
atgagtatcttaaacaatggtatctctcacacaatgattgacggtgcggcttataaagaa
gaagtagaaagcaaagatattatggcagttccaactgtttaccttaatggtgaagagttt
ggcagcggtcgtatgacaatcgaagaaattttaaataaactgggcagcggcccagatgca
gcagagtttgctgataaagatccttacgatgtacttgttgttggtggcggtccggctggt
gcaagtgccgcgatttatgcagcgcgtaaaggtattcgcacgggtattgtagccgagcgc
tttggtggacaagttatggatacaatgggcatcgaaaactttattagcgttaagaaaaca
gaaggtcctaaactcgtagcaagcttagaagagcatgttaaagattacggcattgacgta
atgaatttagtacgcgctcgtagcttaaagaaaaaagaccttgtcgaacttgagctggat
aatggcgctgttttaaaaagtaaaacagtcatcctttcaacaggtgctcgctggcgtaat
gttggtgtacctggagaagcagaattcaaaaacaaaggtgtagcttactgcccacactgc
gatggtcctttattcgaaggtaaacgcgtagccgttattggcggtggaaactcaggcgtg
gaagcagcgattgaccttgcaggtatcgtaaatcacgtaactgtttttgaatatatgtct
gaactgaaagccgatgctgtattacaagagcgcctaaacagccttccaaacgtaactgtc
gtgaaaaacgctcaaacaaaagaaattaccggaactgataaagtaaacggtattacttac
attgatcgtgagacagaggaagaaaaacacgttgaattagaaggtgtattcgttcaaata
ggcttagtaccaaacactgattggttaggcgatgatgtagaacgtacacgtatgggagaa
atcgttgttgataagcatggtgcgactaacattcctggcgtattcgctgcgggagactgc
acagacagtgcttataaacaaattattatctccatgggttcaggtgcaacagcagcttta
ggtgcttttgattatctaatccgtaactga

DBGET integrated database retrieval system