KEGG   Bacillus flexus: BC359_02620Help
Entry
BC359_02620       CDS       T04803                                 

Definition
(GenBank) glycine cleavage system protein H
  KO
K02437  glycine cleavage system H protein
Organism
bfx  Bacillus flexus
Pathway
bfx00260  Glycine, serine and threonine metabolism
bfx00630  Glyoxylate and dicarboxylate metabolism
bfx01100  Metabolic pathways
bfx01110  Biosynthesis of secondary metabolites
bfx01130  Biosynthesis of antibiotics
bfx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BC359_02620
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC359_02620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_H Biotin_lipoyl RnfC_N PTS_EIIA_1 DUF3209
Motif
Other DBs
NCBI-ProteinID: AQX53302
LinkDB All DBs
Position
516171..516554
Genome map
AA seq 127 aa AA seqDB search
MSTPKELRYSEEHEWVKSEGEVFRVGITHFAQSELGDIVFVELPEVGDKVEADEPFGSVE
SVKTVSELYAPISGEVVEVNEELSDNPEFVNESPYEKAWMVVIKPADSADVEKLMTAEQY
DEMINEG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaccaaaagagttgcgttattcagaagagcatgagtgggtaaaaagcgaagga
gaagttttccgggtaggaattacacactttgcacaatctgaacttggtgacattgtattt
gttgagcttccagaagttggcgataaagttgaagcagacgagccgtttggtagcgtagaa
tctgtgaaaacagtatcagagctatatgcaccaattagcggtgaggttgtagaagtaaac
gaagaattaagcgataatcctgagtttgtaaacgagtctccatatgaaaaagcatggatg
gttgtaattaagcctgctgattcggcagatgttgagaagcttatgacagctgaacaatac
gatgaaatgattaacgaaggttaa

DBGET integrated database retrieval system