KEGG   Bacillus flexus: BC359_03855Help
Entry
BC359_03855       CDS       T04803                                 

Definition
(GenBank) acetyl-CoA carboxylase subunit beta
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
bfx  Bacillus flexus
Pathway
bfx00061  Fatty acid biosynthesis
bfx00620  Pyruvate metabolism
bfx00640  Propanoate metabolism
bfx01100  Metabolic pathways
bfx01110  Biosynthesis of secondary metabolites
bfx01120  Microbial metabolism in diverse environments
bfx01130  Biosynthesis of antibiotics
bfx01200  Carbon metabolism
bfx01212  Fatty acid metabolism
Module
bfx_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC359_03855
   00640 Propanoate metabolism
    BC359_03855
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BC359_03855
Enzymes [BR:bfx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     BC359_03855
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BC359_03855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC YafQ_toxin DUF2387 zf-UBP DUF4503
Motif
Other DBs
NCBI-ProteinID: AQX53510
LinkDB All DBs
Position
738824..739711
Genome map
AA seq 295 aa AA seqDB search
MLRDLFTKNTKNAKNTKKKKYASVPSEHLKQDVPEGIMTKCKKCKKIMYTKELNKNLKVC
LNCGHHHQMTAKERISSLIDEGTFIEYDRTMRSQNPLEFPDYVEKLEKDREKTGLSEAIV
TGEGDINGLKVVVAVMDSHFRMGSMGSVVGEKITRAIEKAKDLGVPFLIFTASGGARMQE
GILSLMQMAKTSSALKMYSDKGGLIISIMTHPTTGGVSASFASLGDYNLAEPGALIGFAG
RRIIEQTIREELPEDFQTAEFLLKHGQLDAVVARHNLKETLTNILDIHVGGDVQW
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgttaagagatttatttactaaaaatacaaaaaatgcaaagaatacaaagaagaaaaag
tatgcttcagttccatcagaacacctaaaacaagatgtaccggaaggaattatgacgaag
tgtaaaaaatgtaaaaaaattatgtacaccaaagagcttaataaaaatctaaaagtgtgc
ttaaactgcggacatcatcaccaaatgactgctaaagaaagaattagtagcttaattgat
gaaggtacgtttattgaatatgatcgtacaatgcgctctcaaaaccctttagaatttccc
gattatgttgaaaagttggagaaagaccgtgaaaaaacgggccttagtgaagctattgta
acgggtgaaggagacattaacggtttaaaagtagtcgttgccgttatggattcacatttt
agaatgggaagcatgggctctgttgtaggtgaaaaaattacaagagctatcgaaaaagca
aaggatttaggcgtaccgtttcttatttttacagcatcaggtggagctaggatgcaagaa
ggtatcttaagtttaatgcaaatggctaagacaagctcagcgttaaaaatgtatagtgat
aaaggtggactcattatttccatcatgacgcaccctacaacgggaggcgtatccgctagt
tttgcttcgttaggagattataatctagcagagccgggtgctttaattggttttgcaggt
cgaagaattattgagcaaactattcgagaagagctaccggaggatttccaaactgcagaa
tttttattaaagcacggtcaattagatgcggttgtggcgcgtcacaatttaaaagaaacg
ctcacgaatattttagacattcatgtaggaggtgacgtacagtggtaa

DBGET integrated database retrieval system