KEGG   Bacillus flexus: BC359_03890Help
Entry
BC359_03890       CDS       T04803                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bfx  Bacillus flexus
Pathway
bfx00020  Citrate cycle (TCA cycle)
bfx00480  Glutathione metabolism
bfx01100  Metabolic pathways
bfx01110  Biosynthesis of secondary metabolites
bfx01120  Microbial metabolism in diverse environments
bfx01130  Biosynthesis of antibiotics
bfx01200  Carbon metabolism
bfx01210  2-Oxocarboxylic acid metabolism
bfx01230  Biosynthesis of amino acids
Module
bfx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC359_03890
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BC359_03890
Enzymes [BR:bfx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BC359_03890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AQX53517
UniProt: A0A1S6Z7H7
LinkDB All DBs
Position
746787..748073
Genome map
AA seq 428 aa AA seqDB search
MTNGQKITVTNGVLNVPNNPVIPYIEGDGIGPDIWAAASRVLEAAVEKAYDGEKEIVWKE
VLAGEKAFNETGEWLPAETLDVIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFEGVPSPIKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLINFLQTEMGVNKIR
FPETSGIGIKPVSSEGTERLVRGAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EKEFGDKVFTWAQYDRIVEKEGKDAANKAQAEAEAAGKIIVKDSIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLMLEHLGWTKAAALVMESMEKTIASQVVTYDFARLMDGAKEVKCSEFADELIK
NLGNQVTV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacggacaaaaaattacggtaacaaacggagtattaaatgtacctaacaatcca
gtaattccatatatcgaaggagacggaattggtccggatatttgggcagcagcatctcgt
gtattagaagcagctgttgaaaaagcatatgatggcgaaaaagagattgtttggaaagaa
gtattagcaggggaaaaagcattcaacgaaactggcgagtggctaccagctgaaacatta
gatgttattcgtgagtacataatcgcgattaagggaccattaacaacgccagtaggtgga
ggaatccgttcactaaacgttgctttacgtcaagagttagatttgtttacttgcttacgt
ccagtacgttatttcgaaggtgttccatcaccaattaaacgtccagaagatacggacatg
gttatcttccgtgaaaatacagaggatatctatgctggtatcgagtatgcaaaaggttct
gaagaagttcaaaagttaatcaacttcttacaaactgaaatgggtgttaataaaatccgt
ttccctgaaacatcaggtattggaattaagccagtatcatctgagggtacagagcgctta
gttcgcggagcaattaactatgcaatcgaacacggtcgtaagtctgtaacgcttgttcat
aaaggaaacatcatgaagtttactgaaggtgccttcaaaaactggggttatgaattagct
gaaaaagaattcggcgataaagtatttacttgggctcaatatgaccgcatcgttgaaaaa
gaaggaaaagatgctgcaaataaagcacaagcagaagcagaagctgctggcaaaattatc
gtaaaagattcaattgcagatatcttcttacagcaaatcttaactcgtcctcgtgagttt
gacgtagttgcaacaatgaacttaaatggtgactatatttctgatgctttagctgcgcaa
gtaggtggaattggtattgcaccgggtgctaacattaactatgaaactggacatgcaatc
tttgaagcaacacatggtactgctcctaaatatgcaggtctagacaaagtaaacccttca
tctgtattattatcaggtgtgttaatgctagaacatttaggctggactaaagcagctgcg
cttgtaatggaatcaatggaaaaaacaatcgcttctcaagtagtaacatatgattttgct
cgcttaatggatggagcgaaagaagtaaaatgctctgagtttgcagatgagttaattaaa
aacctaggaaatcaagtaacagtataa

DBGET integrated database retrieval system