KEGG   Bacillus flexus: BC359_06560Help
Entry
BC359_06560       CDS       T04803                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bfx  Bacillus flexus
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bfx01001]
    BC359_06560
Enzymes [BR:bfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BC359_06560
Protein kinases [BR:bfx01001]
 Serine/threonine kinases: Other
  Bacterial family
   BC359_06560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Kinase-like FTA2 Haspin_kinase Pkinase_fungal Myco_arth_vir_N
Motif
Other DBs
NCBI-ProteinID: AQX54001
LinkDB All DBs
Position
1273892..1275853
Genome map
AA seq 653 aa AA seqDB search
MLIGRRLNDRYKILHVIGGGGMANVYLARDMILDRDVAIKVLRLDFANDDAFIKRFHREA
QSATSIAHPNIVSIYDVGEEEDIYYIVMEYVPGMTLKQYILQESPLSLEKAIHIMTQITS
AIAHAHQYGIIHRDIKPQNILIDHDDTAKVTDFGIAVALSSTTITHTNSVLGSVHYLSPE
QARGGLANKKSDIYSLGVVLFELLTGRVPFSGESAVSIALKHLQTETPSPRKWNPSIPQS
VENVVLKATTKDPFYRYNTVEEFEEDLRSAIHPTRHNEQKFIVPDDDEVTKAIPIIKDEP
YGHELEKTAVRKPSNTHQNEVESKKKPRKKSKVILTLALIFLLLAAASVAAVTFIPSLLL
PKDITVPDLHNEDYESAVTELVSLGFNVKDPKDIADDEVQEGDVVKTSPKAGNVVKEGTA
VIIYRSTGKAKVAFDRFNGRDVSEVQKLLESQNYREVRTIEIDSEEPKGTILDQSPKESE
EVVPESTAVTLWISKGPPEIKVKDFSGWTEKSVRDYVAEEEFEIAVENEYSDTVEKGLVI
SQAPKAGSVIKKGDKLTFKVSLGKEEVPPQTVNVQVTIPYEEKNSEGENPEQKVEIYVED
ADNTMSVPIKELTITETVTESFDVLVKEGEPAKYKVVRDGQVIEEKAVEYPEE
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
ttgctaatcgggagacggctaaacgaccgttataaaattctacatgtcattggtggaggt
ggcatggccaacgtttatttagcacgtgatatgattttagatcgcgacgtggcaattaaa
gttctgcggctagattttgctaatgacgatgcttttattaagcgtttccaccgtgaggca
caatctgcaacaagcattgctcatccaaatattgtgagtatttatgatgttggagaagaa
gaggacatctactatattgtaatggaatatgtccctggaatgaccttaaagcaatatatt
ttacaagagtcaccgttatctttagagaaagcgatacatattatgactcaaattacatcc
gcaattgctcatgctcatcaatatggaattattcaccgagatattaaaccacaaaatatt
ctaattgaccatgatgatacggcaaaagtaacggactttggaattgccgtggctttaagc
tcaacaactattacacatacaaactctgtattagggtctgttcattatctatctccagaa
caagcaagaggaggtctagcgaataaaaagtccgatatttattcattaggcgttgtttta
tttgaattgttaactgggcgagtaccattctcgggagagtctgctgtttccattgcacta
aagcacttacaaacggaaacaccctcaccaaggaaatggaatccttctatcccacaaagc
gtagaaaacgttgtattgaaagcaacaacaaaagaccctttttatcgctataatacggta
gaagaatttgaagaagatttacgctctgctattcatcccactcgacacaatgaacaaaag
tttattgtaccagatgatgatgaagtaacaaaagcaattccaattataaaggatgagccg
tatggtcatgaattggaaaagacggctgttcgtaaaccttctaatacacatcaaaatgaa
gtagaatctaagaaaaagcctagaaagaaaagtaaagttattttaacgcttgcgctcatt
tttttattgttagcggcagcgagcgtcgctgctgtgacttttattccttctttactattg
cctaaggatattacggtgcctgatttacataatgaagactatgagtcagccgtgactgag
cttgtatcattagggtttaatgtgaaagatccaaaggatatagctgatgacgaagtacaa
gaaggagatgtggttaaaacatctcctaaagcgggaaatgtggtaaaagaaggtacagct
gttattatctatcgaagtactgggaaagcaaaagtagcgtttgatcgctttaatggccga
gatgtaagtgaagttcaaaagctgcttgaaagtcagaattatcgtgaagtgcgaacaatt
gaaatcgatagtgaggagcccaaaggaacaatattagatcaaagtccaaaagaaagtgaa
gaggttgttccagaaagcacggccgttacgttatggataagcaaaggacctccggaaatt
aaagtgaaggatttctcaggatggacggaaaaaagcgttcgagattatgtagcagaagaa
gaatttgaaattgcagtagaaaatgaatattctgatactgttgaaaaaggtttggttatt
tctcaagccccgaaagctggttcagttattaaaaaaggtgataagctaacgtttaaagtt
tccttagggaaggaagaagtacctcctcaaactgtcaatgtacaagtaacaattccctat
gaggaaaagaatagtgaaggagaaaatcctgagcaaaaagtagagatttacgtagaagat
gcagataatacaatgtctgtgcctattaaagaactaacaattacagaaacggttactgaa
tcattcgatgtgttagtgaaagaaggcgagccagccaagtacaaagtagttcgagatggt
caagtaattgaagaaaaagctgtagaatatccagaagaatga

DBGET integrated database retrieval system