KEGG   Bacillus flexus: BC359_08920Help
Entry
BC359_08920       CDS       T04803                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bfx  Bacillus flexus
Pathway
bfx00620  Pyruvate metabolism
bfx00680  Methane metabolism
bfx01100  Metabolic pathways
bfx01120  Microbial metabolism in diverse environments
bfx01200  Carbon metabolism
Module
bfx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC359_08920
  09102 Energy metabolism
   00680 Methane metabolism
    BC359_08920
Enzymes [BR:bfx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BC359_08920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase GLTSCR1 DUF5347
Motif
Other DBs
NCBI-ProteinID: AQX54413
UniProt: A0A1S6ZA65
LinkDB All DBs
Position
1762321..1765080
Genome map
AA seq 919 aa AA seqDB search
MTVLQTTEQDNSVALRRDVKFLGQLLGNVLIYEGGQELLNKVEKIREVAKILREHNNQDI
YEQLKSEITSIEDPMRQQVIRAFSVYFHLVNIAEQNHRIRRKREYQQQEEANIQPGSLEK
AVSDLKNSGVTADVITKLLETLSLELIITAHPTEATRRSVLDIHKRIADILQAFEQKSVT
KREREELEEQLFNEVMILWQTAELRDRKPRVMDEVANGLYYFDETLFEVLPHIHQELEDS
LKRYYPEQQWQVPNVLRFGSWIGGDRDGNPNVTPKVTWQTLTKHRSVAVRKYRAALLNLR
ERLSQSTKRVLILEDLVQSVEQEKQLLPQKKRWRVPHEVYRCKLTIMLHKLEHVGQEGGY
KQADELLNDIKLIQKSLRLHHPMQYELKSVRQLIRQVELFGFHLATLDIRNHSGEHEAAI
KEILYSVGIVEDYSSLTEKEKLELLSGILQDPRPLISFTEDYSPETKQIIEAFQMIKRAH
EEFGKRSIEVYLISMTQSASDLLEVMVLAKEAGIYRLHANGEIESYLNVAPLLETIDDLT
AGPKIMEELFQLDFYRKHLAEQNDLQEIMLGYSDGSKDGGTLTANWKLYKAQQEIHDMAK
RYNVRLKFFHGRGGSLGRGGGPLNRSILSQPAETLGDGVKITEQGEVLSSRYSLYDIAHR
SLEQAVSTLLTAAAKVSSEAEQTDIRTSQWEEAMNIASKEALAHYQHLVFEDPDFLTYFK
QATPLPELGALNIGSRPMSRKGSDRFEDLRAIPWVFAWTQSRQLLPAWYAAGTGLVHLIK
KEGSLSLLQQMYKEWPFFRSTIDNLQMALTKADLMTAKNYTSMVEDKAIADRIFGAIEKE
YTETKEAILQITDQEELMEHLPNIQSSIRLRNPYVDPLSFFQVELISKLRQADEEQADRL
LQEVLLTINGIAAGLRNTG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgacggttttacaaactactgagcaagacaacagcgtcgcattgcgtcgagacgtcaag
tttcttggacaactactaggaaatgtattaatttatgagggtggacaagagttacttaat
aaagttgaaaaaatacgtgaagtggcaaaaatacttcgtgaacataataatcaggatatc
tatgaacagttaaaatctgaaataacaagcattgaagatccaatgagacagcaagtcatt
cgtgcattttctgtttattttcatctagttaatattgcggaacaaaaccaccgcattcgc
cgcaagcgcgagtatcagcagcaagaagaagcaaacatacagcctggatcacttgaaaaa
gcagtaagtgatttgaaaaatagtggcgtaacagcggacgttattacaaaacttcttgaa
acgctgtctttagagttaattattacagcgcatccaacagaagcaacgagaagaagcgtg
ctggacatccataagcgaattgctgatattttacaagcgtttgaacaaaaatcagtaaca
aaacgtgaacgggaagagttagaagagcagctttttaacgaagtcatgattttatggcaa
acggctgaactacgagatcgtaagccgcgcgtaatggacgaagtggcaaatggattatac
tattttgatgaaacgttgtttgaagtattaccacatattcatcaagagctggaggattca
ttgaaacgctactatcctgagcagcagtggcaagtgccaaacgttctgcgttttggatct
tggattggtggggacagagatggtaatccaaacgtaacgccaaaggtaacgtggcaaacc
ttaacaaagcatcgtagcgtagcggttcgtaagtatagagcagctttattgaatttaagg
gagcgcctaagccaatcaacaaagcgagttttaattttagaagatttagtgcaatcggtt
gaacaagaaaaacagcttttgcctcaaaagaaaagatggcgcgtgcctcatgaggtatat
cgctgtaaattaacgattatgcttcataagttagaacatgttggacaagaaggtgggtat
aagcaggctgacgagctacttaatgatattaagcttattcaaaaaagcttacgtttacat
catccgatgcaatatgaattgaaaagcgttcgtcaattaattcgtcaagtagaattgttt
ggcttccatttagcaacgcttgatattcgaaatcatagcggtgaacatgaagcagcaatt
aaagagattttatattcagttggcattgtagaagactactcttccttgacagaaaaagaa
aagttggagctgctaagcggaatcttacaagatcctcgtccgcttatttcgttcactgaa
gactattcgccagaaacaaagcaaataattgaagcgtttcaaatgattaagcgtgcacat
gaagaattcggaaagcgttcgattgaagtctacttaattagcatgacccaatcagctagc
gatttattagaagtaatggttttggcaaaagaagcaggaatctatcgtttgcatgccaac
ggagaaattgaaagttatttaaacgttgcccctttattagaaacgattgatgacttaacg
gctgggccaaaaattatggaagagctattccaacttgatttttatcgaaaacatttggca
gaacaaaatgatttacaagagattatgctggggtattctgatggaagcaaggatggcgga
acgttaacagcaaactggaagctctacaaagctcagcaggaaattcatgatatggcgaag
cgctataacgtacgccttaaatttttccatggtcgaggtggatctcttggtcgaggcggt
ggtccattaaaccgaagtattttatcgcaacctgctgaaacgctaggagacggcgttaaa
attacagagcaaggagaagtattatcctctcgctattcgctatacgacattgcgcaccga
agcctagaacaagcggtttcaaccttgctaacagcagctgccaaagtgtcgtctgaagct
gaacaaacggatattcgtacatctcagtgggaagaagcgatgaacattgcatcaaaagaa
gcgcttgctcattatcagcatcttgtgtttgaagatccagactttttaacatactttaaa
caagcaacaccgttaccagagttaggtgctcttaacattggatctcgtccaatgagtcga
aaaggcagtgaccgttttgaagacctgcgagctattccatgggtatttgcttggacacaa
agtcgacagcttttgcctgcttggtatgcagctggaacgggtcttgtacatcttatcaaa
aaagaaggaagtctttctctactgcagcaaatgtataaagagtggccatttttccgctca
acaattgataatttgcagatggctttaacgaaagcagacttaatgactgcgaaaaactat
acttcaatggttgaagacaaagcgattgctgatcgaattttcggagcgattgagaaagag
tataccgaaacgaaagaagcaattctacaaattacggatcaagaagaattaatggagcac
ctaccgaatattcaatcgtctattcgattgcgaaatccatacgttgatccgttaagcttc
ttccaagtcgaacttatttccaaacttcgtcaagcagatgaagagcaggctgatagactt
ctacaagaagtgttattaactattaatggaattgcggccggcttgcgtaatacaggctga

DBGET integrated database retrieval system