KEGG   Bacillus flexus: BC359_10035Help
Entry
BC359_10035       CDS       T04803                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bfx  Bacillus flexus
Pathway
bfx00020  Citrate cycle (TCA cycle)
bfx00310  Lysine degradation
bfx00380  Tryptophan metabolism
bfx01100  Metabolic pathways
bfx01110  Biosynthesis of secondary metabolites
bfx01120  Microbial metabolism in diverse environments
bfx01130  Biosynthesis of antibiotics
bfx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC359_10035
  09105 Amino acid metabolism
   00310 Lysine degradation
    BC359_10035
   00380 Tryptophan metabolism
    BC359_10035
Enzymes [BR:bfx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BC359_10035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C Nrf1_DNA-bind
Motif
Other DBs
NCBI-ProteinID: AQX54616
UniProt: A0A1S6ZAP8
LinkDB All DBs
Position
1965813..1968671
Genome map
AA seq 952 aa AA seqDB search
MGNETSNRGEPWKGFLGPNYGYVLEQYELYEEKSDLVDPELKELFDYWGAPPLLDSSYAE
AGDTQPVPAAKTAKIAAAIKLAENIRAYGHLYASIKPLESGKKDPVLLHLEDYGLSKEDL
KAVPVEILCANAPAHVKDGLAAIEYLTDVYTKTMAFEFHHVHNMEENKWLTEMVESGAIF
QPLSDEKRISVLKRLTEVEGFEQFLHRTFVGQKRFSIEGVDMLIPLIDELVARSVEKSPK
TVNIGMAHRGRLNVLAHVLGKPYEMIFAEFQHSPNKELVPSEGSIGINYGWTGDVKYHLG
ADKQIKAENTVRARLTLASNPSHLEFVNPVVEGFTRAAQDDRQTNGYPKQDITKSFAILI
HGDAAFPGEGIVQETLNLNQLSGYQTGGTIHIIANNMIGFTTESVDSRSTKYASDLAKGF
EIPIVHVNADDPEACLAAAYFAYEYRRRFNKDFLIDLIGYRRFGHNEMDEPFVTQPKMYE
IITKRPTVRALYAEQLEKAQVVTKEQVNEISEQLQKKLQTAYDKVPPKAEKRHQIMEMPK
AVFNGIPTLDTSVPKEELLEINRELVTYPEDFKVFPKLDRILSKRAKAFEENGKADWSLG
EAFAFASILRDGTPIRITGQDSERGTFAHRHLVLHDYETGDVYSPLHTMKNVSASFDIRN
SPLSEGSVLGFDYGYNVFAPETLVIWEAQFGDFANAGQVIIDQFISAGRAKWGQKSGMVL
LLPHGHEGQGPEHSSARLERFLQLAAENNWTVANVTSAAQYFHLLRRQAAVLKKEEVRPL
VVMAPKSLLRSAFSVSNMEEFTNGSFRLVVEQPNLGEKTEEVERIVLCSGKISGDLTDRI
QKSDKSLDWLHVLRLEQIYPFPRRVVADLFAKYPNLKEIAWMQEEPENMGAWNYVESKLR
EVAPEGVSVDYIGRRRRSSPAEGDPTTHRQEQERILQEALTKTQIANDVVTR
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgaaacgtcaaacagaggtgagccttggaaagggtttttgggcccaaactat
ggctatgtattagaacagtatgagttatatgaagaaaagtcggatttagtagatccagaa
ctaaaagaactatttgattattggggtgcaccgccattgcttgatagcagctatgctgaa
gcgggagatacacagcctgttccagcagctaagacggctaagattgccgctgccattaag
ctagcagaaaatattcgtgcatacggtcatttatatgcatcaatcaaaccgttagaaagc
ggtaagaaagatcctgtgcttctacatctagaagactatggattatcaaaggaagattta
aaagcagtaccggttgaaattctttgcgcaaatgcgcctgcacatgtaaaggatggtctg
gctgcaattgagtatttaaccgatgtatacacgaagacaatggcgtttgaattccatcat
gtacataacatggaggagaataagtggcttactgaaatggtggagtcaggagcaattttt
caacctctttctgatgaaaagcgtatttcagtattaaagcgtctaacggaagtagaagga
tttgagcaatttctacatcgtacatttgtcggacaaaaacgattctcaattgaaggcgta
gatatgcttattccattaattgatgagctagttgcacgctctgtcgaaaaaagtccgaaa
acagttaatattggaatggcgcaccgcggacgtctaaatgtgttagcacacgtactaggc
aagccgtatgaaatgatttttgctgagttccaacattcaccgaataaagagcttgtacca
tctgagggttcaatcggcattaactatggttggacaggagacgtaaaatatcacttaggt
gcagataagcaaattaaagctgaaaacacagttcgagctcgtttgacattggcaagtaac
ccgagtcatttggaattcgttaatccagttgtggaagggtttacaagagctgctcaggac
gatcgccaaacaaacggttatccaaagcaagacatcacgaaatcttttgcgattctaatt
cacggtgacgcagcgtttccaggtgaaggaattgttcaagaaacgctaaacttaaatcag
ctttctgggtaccaaacgggtggaactattcatattatcgctaacaatatgattggattt
acaacggaaagcgtagactctcgttcaacgaaatacgcgagcgatctagcaaaaggattc
gaaattccgattgtccatgtaaacgcagacgatccagaagcatgtctggcagcggcttac
tttgcatatgagtatcgtcgccgctttaataaagactttttaattgatctgattggatat
cgtcgatttggccacaatgaaatggatgagccatttgtaacgcagccgaagatgtatgaa
attattacaaagcgtccaacggttcgtgcgctttatgctgaacaattggagaaagcacaa
gtcgttactaaagaacaagtgaatgaaatcagtgagcaacttcaaaagaaattgcagact
gcttatgataaagtaccaccaaaagcagaaaagcgtcatcaaattatggaaatgccaaaa
gcagtatttaatggtattccaactttagatacgtctgtgccaaaagaagagcttttagaa
attaaccgagaacttgtgacgtatccagaagattttaaggtatttccaaagttagaccgt
attttgtcaaaacgtgcgaaagcgtttgaagaaaatggtaaagcagactggtcactaggt
gaagcatttgcatttgcaagcattttacgtgacggtacgccaattcgtatcacaggacaa
gactcagaacgtggaacattcgctcatcgtcaccttgtattgcatgactatgagacaggg
gatgtatactcaccactgcacacaatgaagaacgtaagcgcttcctttgatattcgtaac
agtcctctttctgaagggtcagtgttaggatttgattacggatataatgtgtttgcacca
gaaacacttgtgatttgggaagctcagttcggagactttgcaaatgctggtcaggttatc
attgatcaattcatttcagcaggtcgcgcgaagtggggacaaaaatcaggtatggttctc
ttacttccacacggacatgaaggccaagggccagaacattcaagcgcaagattagaacgt
ttcttacagctagctgctgaaaataactggacggtggcaaacgtaacgagcgcggcgcaa
tatttccacttattacgtcgtcaagcggctgttttgaaaaaagaagaggtgcgtccactt
gttgtaatggcaccaaaaagcttgcttcgaagtgcgtttagcgtatcaaatatggaagag
ttcacaaacggttctttccgcttagttgtcgaacaaccaaacttaggtgaaaaaacagaa
gaagttgagcgtatcgttttatgcagcggtaaaattagcggagatttaacagatcgcatc
caaaaatctgataagtcgctagattggttacatgtactacgccttgagcagatctatcca
ttcccaagacgagttgtagctgatttatttgctaaatatccaaacttaaaagaaattgcg
tggatgcaagaagagcctgagaatatgggtgcatggaattatgttgagtctaagcttcgc
gaagtagcacctgaaggcgtgagcgttgattacattggacgcagaagacgttcaagccca
gcagaaggagacccaaccactcatagacaagagcaagagcgtatattacaagaagcatta
acgaaaacacaaatcgctaatgatgtagtgacacgataa

DBGET integrated database retrieval system