KEGG   Bacillus flexus: BC359_15010Help
Entry
BC359_15010       CDS       T04803                                 

Definition
(GenBank) hypothetical protein
Organism
bfx  Bacillus flexus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LapA_dom Phage_holin_3_6 MNHE DUF1129 DivIC Herpes_UL6 SLATT_1
Motif
Other DBs
NCBI-ProteinID: AQX55482
UniProt: A0A4P8XD39
LinkDB All DBs
Position
2928618..2928941
Genome map
AA seq 107 aa AA seqDB search
MKGQSFFILGLIFALIIAILAVINNEPVQFNYVFGSQDWPLILIILTSAVFGGVVAASLS
FVKITQLKSKNKQQTKRIAELETQLATHSEPQADLEKPLSTQGEPSA
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggacaaagctttttcattttaggtcttattttcgctcttattattgctatctta
gctgtcatcaacaatgagccagttcaatttaactatgtctttggctcacaagactggcca
cttattttaattattttaacatcggctgtattcggtggtgtcgtcgctgcttcactaagc
tttgttaaaatcactcagcttaaaagtaaaaacaagcaacaaacaaaacgaattgccgaa
ctagaaacgcaactagccactcactcagaaccacaagctgatctagaaaaacctttatca
acgcaaggtgaaccatcagcttaa

DBGET integrated database retrieval system