KEGG   Bacillus flexus: BC359_16470Help
Entry
BC359_16470       CDS       T04803                                 

Definition
(GenBank) nitrite reductase large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bfx  Bacillus flexus
Pathway
bfx00910  Nitrogen metabolism
bfx01100  Metabolic pathways
bfx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BC359_16470
Enzymes [BR:bfx01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     BC359_16470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Rubredoxin_C Pyr_redox Pyr_redox_3 NIR_SIR_ferr AlaDh_PNT_C NAD_binding_7 3HCDH_N GIDA K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AQX55747
LinkDB All DBs
Position
complement(3224027..3226441)
Genome map
AA seq 804 aa AA seqDB search
MRKEKLIVIGNGMAGIRAVEEIISLSPEIFDITVFGSEPHPNYNRILLSKVLQGDTSVED
ITLNDWNWYEENDITLYIEEKVISIDSINQEIRTDQGRIEFYDKLIIATGSLPFILPIPG
VEKEGVTTFRDISDTNQMVKASQQYKKAAVIGGGLLGLEAARGLLNLGMDVTVVHLSSYL
MERQLDLTAGKLLQQELEQQGMSFLLEKQTQEITGHERVEGLKFSDGNLLETDFVVMAAG
IRPNTELAQKAGLHINRGIVVNDYMETSSANIYAVGECAEHKGMVYGLVAPLYEQGKVLA
KTICGGDVRPYQGSVLSTQLKVSGVDVFSAGDFIEDEQKKSIKVFDEQDGIYKKIVLKGN
QIVGAVLFGDSRDGNRLFSMIQKQQDVSEVEKISILQPISGQGSGSLVASMSADDIVCGC
NGVSKGTIVEAIQNQGCTSVDELKACTSASRSCGGCKPLVAELLQHTLGSEFDGAAQKEA
ICGCTSLSRDEVVEEIRAKGLSHTREVMNVLGWSNEEGCSKCRPALNYYLGMVNPTGYVD
ERESRFVNERMHANIQKDGTYSVVPRMYGGVTNADDLRRIADVVDKYNIPLVKVTGGQRL
DLFGVKKEDLPLVWEELDMPSGYAYGKSLRTVKTCVGEQFCRFGTQDSMGVGIALEKKFE
GLWTPHKVKMAVSACPRSCAESGFKDIGFIGIDGGWEIYVGGNGGTHLRGGDLLYKVKTD
EELMEITGAYLQYYRETANYLERTSAWIERIGIKNVQAILDNVEERKKLNLRIDEALSTY
RDPWKEIVENKQAKKELFETVVTS
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagagaagttaatcgtaattgggaatgggatggctggaattcgagcagttgaa
gagattattagtttgtcccctgaaatatttgatatcactgtatttgggagtgagccacat
ccaaactataatcgcatcttgttatctaaagtattacaaggggatacaagcgtagaagac
attacgctaaacgactggaactggtatgaggagaacgatattactctttatatagaagaa
aaggttataagcattgactcaattaatcaagaaatacgtacggatcaaggaaggattgaa
ttttacgataagttgatcatagcaacgggctctctgccatttattcttccaattccagga
gtagagaaagaaggcgttacaacgtttcgagatataagcgatacgaatcaaatggtaaaa
gcatctcagcagtataaaaaagcagctgtaattggaggcggattattaggtttagaagca
gcgagaggacttttaaacttaggaatggatgtaacggttgttcatttatcctcttattta
atggagcgtcagttggatttgactgctggaaagttgcttcaacaagagttagaacagcaa
gggatgagtttcttgcttgagaaacaaacccaagaaatcacgggtcatgagcgcgtagaa
gggttaaagttctcagacggaaacctattggaaacagattttgtagtaatggcagcaggc
attcgaccgaatactgaacttgctcaaaaagcgggtcttcatatcaaccgtggaattgtg
gtaaatgattatatggaaacgagtagtgccaacatttatgccgtaggcgaatgcgcagag
cataaaggtatggtttatgggttggtagctcctctttacgagcaaggaaaagtactagct
aaaacgatctgtggaggagatgtacgtccttatcaagggtctgttctatccactcagtta
aaggtatcgggcgtagatgttttttcagccggtgattttatagaagatgaacaaaagaaa
tcgatcaaggtattcgatgagcaagatggtatttacaaaaaaattgttttaaaaggaaat
caaattgtaggggccgttttatttggtgacagccgtgatggaaaccgcttgttttccatg
attcaaaagcaacaggacgtatcggaagtggagaagatttcaattctacaaccaataagc
gggcaaggaagcggaagtctggtagcaagtatgagtgcggatgatattgtttgtggatgt
aatggcgtatcgaaaggaacgattgtagaagctattcaaaatcaaggctgtacatcagtg
gatgagcttaaagcctgtacgagtgcttcacgttcgtgcggagggtgtaagccgcttgtt
gctgaattgcttcagcacacgcttggaagtgagtttgatggagcagctcaaaaggaagcg
atatgtggatgtacatctctttctcgagatgaggtggtagaggaaattcgagcaaaaggc
ttatctcatacgcgtgaagtgatgaatgtgcttggatggagtaacgaagaaggttgttct
aagtgtcgtccagcattgaattactacttgggtatggtgaatccaactggctatgtagat
gaacgagaatctagatttgtaaatgaacgtatgcatgctaatatccaaaaggatggtacg
tattctgttgttcctcgaatgtacggaggtgtcacgaacgcagatgatttacgacgcatt
gctgacgtggttgataaatacaacatcccgcttgtaaaagtaacgggaggacagcgttta
gacttattcggtgtaaagaaagaagatttacctttagtgtgggaagagctagatatgcct
tctggttatgcttatggcaaatcacttcgaacggtgaagacgtgtgttggagaacaattt
tgccgctttggtacgcaggattcgatgggagtagggattgcgctggaaaagaaatttgaa
ggattatggactcctcataaagtaaagatggctgtatcggcctgtccaagaagctgtgct
gaatcaggctttaaagatattggctttattggaatagacggtggttgggaaatttatgtt
ggtggtaatggaggcactcatttacgaggaggcgatttgctatataaggtgaaaacagac
gaagagttaatggaaattacaggagcttatctacaatattaccgtgaaacggcaaattat
ctagagcgtacttcagcttggattgaacgaatcggtattaaaaacgttcaggctattctt
gataatgtagaggaaagaaagaaactaaaccttcgtatagatgaagccttatctacgtat
cgagatccatggaaggaaatcgttgagaacaagcaagcaaaaaaagaattgtttgagaca
gttgtaacatcataa

DBGET integrated database retrieval system