KEGG   Bacillus flexus: BC359_19735Help
Entry
BC359_19735       CDS       T04803                                 

Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
bfx  Bacillus flexus
Pathway
bfx00030  Pentose phosphate pathway
bfx00680  Methane metabolism
bfx01100  Metabolic pathways
bfx01120  Microbial metabolism in diverse environments
bfx01200  Carbon metabolism
bfx01230  Biosynthesis of amino acids
Module
bfx_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
bfx_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BC359_19735
  09102 Energy metabolism
   00680 Methane metabolism
    BC359_19735
Enzymes [BR:bfx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     BC359_19735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase PRAI PEP_mutase Ribul_P_3_epim 4HFCP_synth
Motif
Other DBs
NCBI-ProteinID: AQX56301
UniProt: A0A4P8XCR6
LinkDB All DBs
Position
3874132..3874764
Genome map
AA seq 210 aa AA seqDB search
MELQLALDLVNIPEAIELVKQVEEHIDIVEIGTPVVINEGLHAVKAVKEAFPNLKVLADL
KIMDAAGYEVMKASEAGADIITILGAAEDMSIKGAVEEAKKQGKKILVDMIAVKDLAGRA
KEVDAMGVDYICVHTGYDLQAVGKNSFEDLQTIKGVVKNAKTAIAGGIKLNTLPEVIKVQ
PDLVIVGGGITGQADIKAAAAKMQQMINQG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaattacaattagcattagatttagtcaacatcccagaagcaattgagctggtaaaa
caagtagaggaacatattgatatcgttgaaatcggtacgccggttgtaatcaatgaaggt
cttcatgctgtaaaggcagtaaaagaagcatttcctaacttaaaagtattagcagacctg
aaaattatggatgctgctggatatgaagtgatgaaagcttctgaagcaggtgcagatatc
atcactattcttggagctgctgaagatatgtcaatcaaaggtgctgttgaagaagcgaag
aagcaaggtaaaaaaatccttgttgatatgattgctgtaaaagaccttgctggacgtgca
aaagaagtagacgctatgggcgttgattatatttgtgttcatactggttatgatcttcaa
gcagttggaaagaactcttttgaagatttacaaaccatcaaaggtgttgtaaaaaatgct
aaaactgcaatcgcaggtggtattaaattaaatacacttccagaagtcatcaaagtacaa
ccagaccttgtcattgtaggtggcgggattactggacaagctgatataaaagctgctgct
gccaaaatgcaacaaatgattaatcaagggtaa

DBGET integrated database retrieval system