KEGG   Bacillus flexus: BC359_19960Help
Entry
BC359_19960       CDS       T04803                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bfx  Bacillus flexus
Pathway
bfx00473  D-Alanine metabolism
bfx01100  Metabolic pathways
bfx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BC359_19960
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BC359_19960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bfx01011]
    BC359_19960
Enzymes [BR:bfx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BC359_19960
Peptidoglycan biosynthesis and degradation proteins [BR:bfx01011]
 Precursor biosynthesis
  Racemase
   BC359_19960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AQX56325
UniProt: A0A1S6ZFF8
LinkDB All DBs
Position
complement(3902542..3903714)
Genome map
AA seq 390 aa AA seqDB search
MVKAFYRETWAEINADAILYNVQEVKKLLKPDQKLMAVVKANAYGHGDVEVADLALQAGA
NMLAVAFLDEAISLRQKGVKAPILVLGAVPPLHVKEAIKWNVTITAYSKQWIEEVIADQA
NNGRLTIHLKIDTGMGRLGLRSDDEIKAVATLLKSQSFMEVEGVFTHFATADELNSIYFQ
NQYHRFQSVVQLIQSLGINPPLVHCANSAAIFQQPENLFTAARLGISMYGLSPSPEMKEI
ISVPLKEAFSLHSTLVHVKKVEPGSGISYGITYESEKAEWIGTVPIGYADGWIRKLHNFT
ILVKGKKVPVVGRICMDQLMVRLPEQYPVGTKVTLIGKQGNEQISIDQVAQHLETINYEV
PCMISARVPRVIVKNQEQVNITNYLLNEHN
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagcattttaccgagaaacatgggcagaaattaatgcagatgcaattttgtat
aatgttcaagaagttaaaaagttattaaaaccggatcaaaagctcatggctgtagtgaaa
gcaaatgcatatgggcacggagatgtagaagtagcagatttagcactacaagcaggtgct
aatatgttagcagttgcatttttggatgaagcaatctcacttcgtcagaaaggggttaaa
gcccccattttagtactaggagctgtgccgcctcttcatgttaaagaggctattaaatgg
aatgttacgataactgcttatagtaagcaatggatagaagaagtaattgcagaccaagct
aataatggaaggttaactattcatttgaaaatagatactggaatgggaagactaggctta
cgaagtgatgatgagatcaaggcagtagcaacactgttaaaatcacaatcctttatggaa
gtagagggagtatttactcactttgcaacggcagatgaactaaattcaatttactttcaa
aatcaatatcacaggtttcaaagcgtagtgcagcttattcagtctttaggaattaatcct
cctctggttcactgtgcaaacagtgcggctatttttcagcaacctgagaatttgtttacc
gctgctagactagggatttcaatgtatgggttaagcccgtcaccagagatgaaggaaatc
atttctgtccctttaaaagaagctttttcattgcatagtacacttgtacatgttaaaaaa
gtagagccaggtagtggtattagctatggtattacgtatgaatcagagaaagcagaatgg
attggaacggttccaattggctacgcggacggatggattcgaaagcttcataactttact
atccttgttaaaggaaagaaagttcctgtggtgggacgtatttgtatggatcaactaatg
gtacgccttccagagcagtatccagtaggtacaaaagtgacgcttattggtaagcagggc
aacgaacaaatatccattgatcaagtagcacagcacttggaaactattaactacgaagta
ccttgtatgatttcagctcgtgtaccaagggtgattgtgaagaatcaagagcaagtgaat
attactaactacttgttgaacgaacacaattga

DBGET integrated database retrieval system