KEGG   Bordetella flabilis: BAU07_01290Help
Entry
BAU07_01290       CDS       T04592                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bfz  Bordetella flabilis
Pathway
bfz00020  Citrate cycle (TCA cycle)
bfz00480  Glutathione metabolism
bfz01100  Metabolic pathways
bfz01110  Biosynthesis of secondary metabolites
bfz01120  Microbial metabolism in diverse environments
bfz01130  Biosynthesis of antibiotics
bfz01200  Carbon metabolism
bfz01210  2-Oxocarboxylic acid metabolism
bfz01230  Biosynthesis of amino acids
Module
bfz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAU07_01290
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAU07_01290
Enzymes [BR:bfz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BAU07_01290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF4115 Phage_head_fibr
Motif
Other DBs
NCBI-ProteinID: ANN75940
UniProt: A0A193G7Y6
LinkDB All DBs
Position
complement(271196..273427)
Genome map
AA seq 743 aa AA seqDB search
MSTTSKIIYTLTDEAPALATYSLLPIVQAFARSSGVTVETRDISLAGRIIAVFPEYLTDA
QKISDDLAELGKLATTPQANIIKLPNISASIPQLKAAIKELQQQGYKLPDYPDEVANDKD
KDVKARYDKIKGSAVNPVLREGNSDRRAPLSVKNYARKHPHKMGAWSAGSKSHVAHMDGG
DFYGSEKSALIADAGTVKIELTAADGTRTVLKEKTNVKAGEIIDAAVLSKKKLRSFLEAQ
IEDAKKQGVLFSVHLKATMMKVSDPIIFGHVVSVFYKDVLSKHADALKQAGFDPNNGIGD
LYAKLNALPADQRAAIEADIQAEYAQRPQLAMVNSDKGITNLHVPSDVIVDASMPAMIRE
GGKMWGPDGQLYDTKAVIPDRSYADVYQVVIDDCKKNGPFDPVTMGSVPNVGLMAQAAEE
YGSHDKTFQVPADGVVRVTDEAGKVLLEQTVEAGDIWRMCQTKDAPVQDWVKLAVNRARA
TGTPAVFWLDKNRAHDAQIIAKVERYLKDHDTKGLDLRIMTPVEATRFSLERIREGKDTI
SVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVQQFVEEGFL
RWDSLGEFMALAASLEHLADVYKNAKAKVLAKTLDEATGKFLDTDKSPARKVGGLDNRGS
HFYLALYWAQALAAQTDDKDLQAKFAGIAKALADNEAKIVQELGAVQGKPVDIGGYYRPN
PDKASKAMRPSATLNDALKSLSA
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccacgtcgaagatcatctatacgctgaccgacgaagcgccggccctggccacg
tattcgctgctgcccatcgtccaggcgtttgcccgttcgtcgggcgtcacggtcgaaacc
cgcgatatctcgctcgccggccgcatcatcgcggtcttccccgagtatctgacggatgcg
cagaagatctccgacgacctggcggagctgggcaagctggcgaccacgccgcaagccaat
atcatcaagctgccgaacatcagcgcgtccattccgcagttgaaggccgccatcaaggaa
ctgcagcaacagggctacaagctgccggactatccggacgaggtcgccaacgacaaggac
aaggacgtcaaggcgcgctatgacaagatcaagggcagcgccgtcaatccggtcctgcgc
gaaggcaactccgaccgccgcgcgccgctgtcggtgaagaactacgcccgcaagcatccg
cacaaaatgggcgcctggagcgccggctccaagtcgcatgtcgcgcatatggacggcggc
gatttctacggcagcgaaaaatccgccctgatcgccgatgccggcaccgtgaagatcgaa
ctgacggcggccgacggcacgcgcacggtcctcaaggaaaagaccaacgtcaaggccggc
gagatcatcgacgccgccgtgctcagcaagaaaaagctgcgcagcttcctggaagcccag
atcgaggacgccaagaagcagggcgtactgttctccgtacacctgaaggccaccatgatg
aaggtctccgaccccatcatcttcggccacgtggtctccgtgttctacaaggacgtcctg
tccaagcatgcggacgccctgaagcaggccggcttcgatcccaacaacggcatcggcgac
ctgtacgccaagctgaacgccctgcccgccgaccagcgcgccgccatcgaggccgacatc
caggccgaatacgcgcagcgcccgcaactggccatggtcaattcggacaagggcattacc
aacctgcacgtgcccagcgatgtcatcgtggacgcgtccatgcctgccatgattcgcgaa
ggcggcaagatgtggggcccggacggccagttgtacgacaccaaggccgtcatcccggac
cgcagctacgccgacgtctaccaggtggtgatcgacgactgcaagaagaacggtcccttc
gatccggtgaccatgggcagcgtgcccaacgtgggcctgatggcgcaggccgccgaggag
tacggttcgcacgacaagaccttccaggtgccggccgacggcgtggtgcgtgtcaccgac
gaagccggcaaggtgctgctggagcaaaccgtggaggcgggcgacatctggcgcatgtgc
cagaccaaggatgccccggtgcaggactgggtcaagctggccgtcaatcgcgcccgcgcc
accggcacgccggccgtgttctggctggacaagaaccgcgcccacgacgcgcagatcatc
gccaaggtcgaacgctacctgaaggaccacgacaccaagggcctggacctgcgcatcatg
acgccggtggaagccacgcgcttttcgctggaacgcatccgcgagggcaaggacaccatc
tcggtgaccggcaacgtgctgcgcgactacctgaccgacctcttccccatcatggaactg
ggcaccagcgccaagatgctgtccatcgttccgctgatggccggcggcggcctgttcgag
accggcgcgggcggctcggcgcccaagcatgtgcagcagttcgtcgaggaaggcttcctg
cgctgggattcgctgggcgaattcatggccctggccgcctcgctggaacacctggccgac
gtgtacaagaacgccaaggccaaggtgctggccaagacgctggacgaagccaccggcaag
ttcctggacacggacaagtcgcccgcccgcaaggtcggcggcctggacaaccggggcagc
cacttctacctggcgctgtactgggcacaggccctggccgcgcagaccgacgacaaggac
ctgcaggccaagttcgccggcatcgccaaggccctggccgacaacgaagcgaagatcgtg
caggaactgggcgccgtgcaaggcaagccggtggacatcggcggctactaccgtccgaat
ccggacaaggccagcaaggccatgcgtcccagcgccacgctgaatgacgcgttgaagtcg
ctgagcgcctga

DBGET integrated database retrieval system