KEGG   Bordetella flabilis: BAU07_02050Help
Entry
BAU07_02050       CDS       T04592                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bfz  Bordetella flabilis
Brite
Enzymes [BR:bfz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BAU07_02050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ANN76064
UniProt: A0A193G9W7
LinkDB All DBs
Position
459896..460588
Genome map
AA seq 230 aa AA seqDB search
MTVDHPIFTRWPIQYPDRLQLYSAPTPNGVKVGIMLEETELAYEPHRVDIMANENHDPAF
LALNPNGKIPAIYDPHGPRGRPLALFESGAILIYLADKTGQLLSTDPGTRYETIQWLMWQ
MGGVGPMFGQVGFFNKFAGKAYEDKRPLQRYAAESARLLGVLDARLADRDWVMGADYSIA
DISLLGWVRNLIGFYEARELVGFDRFRQVRIWLDRGLARPAVQRGLVVTA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcgatcatccaattttcacgcgttggccgattcaatatcctgatcggttgcaa
ctctattccgcgccgacgcccaacggagtgaaggtcggaatcatgctcgaggagacggag
ctggcctatgagccacaccgcgtcgacatcatggcgaacgagaaccacgatccggccttc
ctcgcgctgaaccccaatggaaaaatcccggctatctacgatccgcacgggccgaggggt
cggccactggcgctgttcgaatcgggagcgatcctgatctatctcgccgacaagaccggg
caactcctttccaccgatcccggcacgcgatatgaaacgatacagtggctgatgtggcag
atgggcggtgtcgggccgatgttcggccaggtcggcttcttcaataaattcgctggcaag
gcctatgaggacaagcgtccgttgcaacgctacgcggccgaatcagcgcggctgctgggt
gtgctcgacgcacgcctcgccgaccgagactgggtgatgggtgcggactacagcatcgca
gacatttcgctgctcggctgggtgcgcaacctgatcggcttttacgaagcacgcgagctc
gtcggcttcgaccgctttcgtcaggtgcggatatggctcgatcgtggcctggcgcgtccg
gctgtgcagcgcggcctggtggtaaccgcctag

DBGET integrated database retrieval system