KEGG   Bordetella flabilis: BAU07_08000Help
Entry
BAU07_08000       CDS       T04592                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bfz  Bordetella flabilis
Pathway
bfz00020  Citrate cycle (TCA cycle)
bfz00310  Lysine degradation
bfz00380  Tryptophan metabolism
bfz01100  Metabolic pathways
bfz01110  Biosynthesis of secondary metabolites
bfz01120  Microbial metabolism in diverse environments
bfz01130  Biosynthesis of antibiotics
bfz01200  Carbon metabolism
Module
bfz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAU07_08000
  09105 Amino acid metabolism
   00310 Lysine degradation
    BAU07_08000
   00380 Tryptophan metabolism
    BAU07_08000
Enzymes [BR:bfz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BAU07_08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ANN77055
UniProt: A0A193GB46
LinkDB All DBs
Position
1824374..1825603
Genome map
AA seq 409 aa AA seqDB search
MAITDVKVPQLSESVSEATLLTWKKQPGAAVEADEILIEVETDKVVLEVPAPASGVLAEI
VKGDGSTVTSDEVIARIDTAGKAAAAAPTSPAAAEPPKAAQTAAAAAPAAAPAAASSTPV
ASPAAAKILADKGVSPEGLAGSGRGGRITKGDALEAGAKPAAAAASAPAPTQLSLDGRPE
QRVPMSRLRARVAERLLQSQQENAILTTFNEVNMQAVIDLRNKYKEKFEKEHGVKLGFMS
FFVKAAVAALKKYPVINASVDGKDIIYHGYFDIGIAVGSPRGLVVPILRNADQLSIAEIE
KTIADFGKRAGEGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGVHATKERPV
VENGQIVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDPQRLLLEL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggccattaccgacgttaaagttccccaattgtccgaatccgtgtccgaggctaccctg
ctgacgtggaagaagcagcctggcgccgcggtggaagcggacgaaatcctgatcgaggtc
gagaccgacaaggtcgtgctggaagtgcccgcgccggcatccggcgtgttggccgagatc
gtcaagggcgacggcagcaccgtgacgtcggacgaagtgatcgccaggatcgacacggcc
ggcaaggctgccgccgccgcgccgacctccccggcggcagcggagccgcccaaggctgct
cagaccgccgctgcggccgcacccgccgccgcgccggccgcggcatcgagcacgcctgtt
gcgtcgcccgccgccgcgaagatcctcgctgacaagggcgtatcgcctgaaggcctcgcc
ggctccggccgcggtggccgtatcaccaaaggcgacgcgctggaagcgggcgccaagccc
gcggcggcggctgcgtccgcccccgcgcccacgcaattgtcgctggacggccgtcccgag
cagcgtgtgcccatgagccgcctgcgcgcccgcgtggcggaacgcctgctgcagtcccag
caggaaaacgccatcctgaccacgttcaacgaggtcaacatgcaggccgtcatcgacctg
cgcaataagtacaaggaaaagttcgagaaggagcacggcgtcaagctgggcttcatgtcc
ttcttcgtgaaggccgccgtcgccgcgctgaagaagtacccggtcatcaacgcgtcggtg
gatggcaaggacatcatctatcacggttacttcgacatcggcatcgccgtgggcagcccg
cgcggcctggtggtgcccatcctgcgcaatgccgaccagctcagcatcgccgagatcgaa
aagaccattgcggacttcggcaagcgcgccggcgaaggcaagctcagcatcgaggaaatg
acgggcggcacgttctccatttcgaacggcggcgtcttcggctcgatgctgtccacgccc
atcatcaacccgccgcagtcggccatcctgggcgtccatgccaccaaggagcgcccggtg
gtcgaaaacggccagatcgtgatccgcccgatcaactacctggccatgtcctatgaccac
cgcatcatcgacggccgcgaagccgtgctgggcctggtggccatgaaggaagcgctggaa
gatccgcagcgcctgctgctggaactgtaa

DBGET integrated database retrieval system