KEGG   Bordetella flabilis: BAU07_08600Help
Entry
BAU07_08600       CDS       T04592                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bfz  Bordetella flabilis
Pathway
bfz00970  Aminoacyl-tRNA biosynthesis
bfz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAU07_08600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bfz03029]
    BAU07_08600
Enzymes [BR:bfz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BAU07_08600
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BAU07_08600
Mitochondrial biogenesis [BR:bfz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BAU07_08600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ANN77161
UniProt: A0A193GCH8
LinkDB All DBs
Position
1957413..1958732
Genome map
AA seq 439 aa AA seqDB search
MQTIQQLQTDLQAGRVTSERLVEQSLEAIEDYRKSGGAAFVHVDAAAALDAARASDAARR
VGYVPSVIAGLPISVKDLFDVRGQVTAAGSRVLASAPAATEDAEAVARLRAAGAILVGRT
NMSEFAFSGLGVNPHYGTPRAPHDDTRVAGGSTSGGAVSVAKGMAVATLGTDTGGSIRIP
AAFCDLVGFKPTAHRVSLRGGVPLSRTLDSAGPLARSVACCATLDRILSGQSLDARPAPL
AGLRLYVTRDFVMDGADAAVEQAFEAALARLSARGATIVPFDFPELRDLPTINAGGGFTA
AEAWQWHRKLLSERGDAYDPRVAMRIRRGEKQSAGDYIELIDARARMMAIAATRLREADA
WLMPTVAVVPPRVSELQQDDAFFATNAMVLRNTSVLNFLDGCAVSLPTGRAGIGLAVCGL
HNADARVLQVSGAIEAELA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatacagcagttgcagaccgacttgcaggccggccgcgtcacgagtgaacgt
ctggtcgaacagtcgctcgaagccatcgaagactatcgcaagagcggtggcgcggccttc
gtgcatgtcgacgcggcggccgcgctggatgccgcgcgcgccagcgacgcggcgcgtcgc
gtgggctatgtgccgtcggtgatcgccggcctgcctatctcggtcaaggatttgttcgac
gtgcgcggacaggtcactgccgcaggttcgcgcgtgctggcatcggccccggcagccacc
gaagacgcggaagcggtcgcgcgcctgcgggccgcgggtgcgatcctggtgggacgcacc
aatatgagcgagttcgcgttctccggcctgggggtgaatccgcattacggcacgccgcgc
gcaccgcacgacgacacgcgcgtggccggcggatcgacctcgggcggcgcggtaagcgtc
gccaagggcatggccgtcgccaccttgggtaccgatacgggcgggtcgatacgcattccg
gcggccttttgcgacctggtcggtttcaagccgaccgcgcatcgggtttcgctgcggggc
ggcgtgccgctgtcgcgcacgctggattcggctggccccctggcgcggtcggtcgcctgc
tgcgccacgctggaccgcatcctcagcggccaatcgttggatgcgcgccccgcgccactg
gcaggcttgcgcctgtacgtcacgcgtgacttcgtgatggacggcgccgacgcggcggtg
gagcaggccttcgaagcggccttggcccggctgtccgccaggggcgccaccatcgtgccc
ttcgattttcctgagctgcgcgacttgccgaccatcaatgccggtggcggtttcacggct
gccgaggcatggcaatggcatcgcaagctgctgtccgagcgcggcgatgcctatgacccg
cgcgtggccatgcgcatacgccgtggtgaaaagcagtccgcgggcgactatatcgagctg
atcgacgcgcgtgcgcgcatgatggccatcgcggccactcgtctgcgcgaggccgatgcc
tggctgatgcccaccgtggcggtggtaccgccgcgcgtcagcgagctgcagcaggacgac
gccttcttcgcgaccaatgccatggtcctgcgcaataccagcgtcctcaatttcctggat
ggctgcgccgtatcgctgccgaccggtcgagccggcatagggctggcggtgtgcgggctg
cacaacgccgatgcccgcgtcctgcaggtctccggggcgatcgaagccgaactggcctga

DBGET integrated database retrieval system