KEGG   Bordetella flabilis: BAU07_11095Help
Entry
BAU07_11095       CDS       T04592                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bfz  Bordetella flabilis
Pathway
bfz00500  Starch and sucrose metabolism
bfz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BAU07_11095
Enzymes [BR:bfz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BAU07_11095
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BAU07_11095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ANN77579
UniProt: A0A193GE61
LinkDB All DBs
Position
complement(2536091..2539450)
Genome map
AA seq 1119 aa AA seqDB search
MTTEDSTVNTPDRDDPLWYKDAVIYQLHIKSFFDANNDGVGDFAGLIEKLDYISALGVNT
IWLLPFYPSPRRDDGYDIADYRGVHPDYGALADVRKFIRAAHARGLRVITELVVNHTSDQ
HPWFQRARNAKPGSAARNYYVWSDNDQSYAGTRIIFLDTEKSNWTWDPVAGAYFWHRFYS
HQPDLNYDNPQVLKEVLGVMRYWLDMGVDGLRLDAVPYLVEREGTNNENLPETHAVLKKI
RSQLDAEYNGRMLLAEANQWPEDAQEYFGKGDECHMCFHFPLMPRMYMAIAREDRFPITD
IMRQTPDIPENCQWAVFLRNHDELTLEMVTSSERDYLWDVYAADRRARLNLGIRRRLAPL
MERDRRRIELMNSLLFSMPGTPVIYYGDELGMGDNVHLGDRDGVRTPMQWSPDRNGGFSR
ADPERLPLPPLMGPLYGYEAVNVEAQTRDPHSLLNWTRRMLATRRQTRAFGRGTLRFLFP
GNRKILAYLREYEDTVILCVANLSRAPQPVELDLSAMNGRVPVELLGGTPFPAIGELPYL
LTLPPYGFYWFELSSVASPPAWHATHPEQMPEYYTLVLRGRAGYELTEGAVRSLREDVLP
IYLARQRWFPKDQKVRSAQPAYAVQLKGTDQECFIAEMQVELDGKPTRFLLPVALIWSET
LPPMAQQYALARVRRAAEMGMVTDAYTLPTFIHALVRGLRERLELPVPRAHPPAVLHFRG
EAGLEDLDIPPDAEVSWFTGEQSNSSITIGGSVMLKLLRRVVPGVHPEAEMTRRLTQAGY
ANSAQLLGEIVRVDEDGTPHTLALMHTVITNQGDAWSWTLEYLKRTLEAAALTAESAAEY
DEDLRGYTAFACAIGKRLGELHATLAQPCEDAAFEPHRANAHDADKRAADVVAMLDRGLK
LLQDNASRLDAGSSQKAQRLIAQREELVEVIQSLAAHEAGSMHIRIHGDFHLGQVLVAQS
DAYIIDFEGEPARPLAERRAKSSASRDVAGLLRSFDYAAATVANGFGDAESGGTEVQPAE
AVLRRRRRDLIDRFRHIANEAFLSAYQEVSRNAEHRWMDESQESALIDLALIEKAAYEIG
YEAAHRPDWVCIPLNGLATLADRLLSSETASGQTPANAE
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagaagacagcaccgtcaacacccccgacagggacgacccgctctggtacaag
gacgcggttatctatcaactgcacatcaagtcgttcttcgatgcgaacaacgacggcgtg
ggcgacttcgcggggctcatcgagaagctcgactacatatccgcgctgggcgtcaacacg
atctggctcctgcccttctacccttcgccgcgccgcgacgacggctacgacatcgccgac
tatcgcggcgtgcaccccgactatggcgcgctggccgatgtgcgcaagttcatccgtgcg
gcgcatgcgcgcggcttgcgcgtcattaccgaactggtcgtgaaccacacctcggaccag
cacccctggttccagcgtgcgcgcaacgccaagccgggatcggcggcacgcaactactac
gtgtggtcggacaacgaccaatcctatgccggcacgcgcatcatcttcctggatacggaa
aagtcgaactggacctgggatccggtggccggcgcatacttctggcatcgcttctattcc
caccagcccgacctgaactacgacaatccccaggtgctgaaggaagtcctgggggtgatg
cgctattggctggacatgggcgtggacggactgcggctggacgccgtgccctacctggtg
gaacgcgaggggaccaacaacgagaacctgcccgaaacgcacgcggtactgaagaaaatc
cgctcgcagctggatgcggagtacaacggccgcatgttgctggcggaagccaaccagtgg
cccgaagacgcccaggaatacttcggcaagggcgatgaatgccacatgtgttttcacttc
ccgctgatgccgcgcatgtacatggcgatcgcacgggaagaccgttttcccattaccgac
atcatgcggcagacgccggacatcccggagaactgccaatgggccgtgttcctgcgcaac
cacgatgaactgacgctggagatggtcaccagcagcgagcgcgattacctgtgggacgtg
tacgcggcggaccgacgcgcccgcctgaacctgggcatacggcgccgcctggcgccgctg
atggaacgcgaccggcgacgcatcgagttgatgaacagcctgctgttctccatgcccggc
acgccggtcatctattacggcgacgagctcggcatgggcgacaacgtgcacctgggcgac
cgcgacggcgtgcgtacgcccatgcagtggtcgcccgaccgcaatggcggcttctcgcgt
gccgatccggaacgcctgccgctgccgcccttgatgggaccgctgtacggctacgaagcc
gtcaacgtcgaggcgcagacgcgcgacccgcattcgctgctgaactggacgcgccgcatg
ctggccacgcggcgccagacgcgcgccttcggccgtggcacgctgcgcttcctgttccca
ggcaaccgcaagattctcgcttacctgcgcgaatacgaagacacggtcatcctttgcgtc
gcgaacctgtcgcgcgcgccgcagccggtggaactggacctatccgcgatgaacggacgc
gtgcccgtcgaactgctgggcggaacgcccttccccgcgatcggcgaactcccctacctg
ctgactttgccgccctatggtttttactggttcgaattgagctcggtggcgtcaccgccc
gcctggcatgccacccatccggaacaaatgcccgaatactacacgttggtcctgcgcggt
cgcgccggctacgaattgaccgaaggcgcagtgcgttccctgcgcgaagacgtgctgccg
atctacctcgcacgccagcgctggttccccaaggaccagaaagtgcgttcggcccagccc
gcctatgccgtgcaactcaagggaaccgaccaggagtgcttcatcgccgaaatgcaggtg
gaactggatggaaagcccacgcgcttcctgttgcccgtcgccctgatctggagcgaaacg
ctgccgcccatggcgcagcagtatgcgctggcccgcgtgcggcgcgccgcggaaatgggg
atggtcaccgacgcctataccttgcccaccttcatccacgcgctggtgcgcgggctgcgc
gaacggctggaactgccggtgccgcgcgcccatccgcccgccgtccttcatttccggggc
gaggcggggctggaggacctggatatcccgccggatgcggaagtcagctggttcacgggc
gaacagtcgaacagctccatcaccatcggcggcagcgtcatgttgaagctgctgcggcgc
gtggtgcccggagtccatcccgaggccgaaatgacgcgccggctgacgcaggccggctat
gccaatagcgcccagttgctcggggagatcgtgcgcgtcgacgaagacggcacgccgcac
acgctcgcgctgatgcatacggtcatcacgaaccagggcgacgcatggagctggacgctg
gaatacctgaagcgcacgctggaagccgcggcgctcacggcggaaagcgccgcggagtac
gacgaagacctgcgcggctacaccgccttcgcctgcgccatcggcaagcggctgggtgag
ttgcacgccacgctggcgcagccctgcgaggatgcggccttcgagccgcatcgcgccaac
gcgcacgatgccgacaagcgcgccgccgatgtggtggccatgctcgatcgcgggctgaag
ctgctccaggacaacgcttcccggctggatgccggcagcagccaaaaggcgcaacggctg
atcgcgcagcgcgaggaactggtcgaagtcatacagtccctcgcggcgcatgaagccgga
tcgatgcatatccgtatccatggtgatttccacctgggacaagtgctggtcgcgcagagc
gatgcctacatcatcgacttcgaaggggaaccggcccgcccgctggcggaacgtcgcgcc
aagagcagcgcatcacgcgatgtcgcgggcctgttgcggtcgttcgactatgcggccgcc
acggtggccaacggcttcggcgatgcggaatcgggcggcaccgaggtgcagcccgcggag
gccgtcctgcgccgtcgccggcgcgacctcatagaccgcttccgccacatcgccaacgag
gccttcctgtccgcttaccaggaggtctcgcgcaatgccgagcaccgctggatggatgag
agccaggagtcggcattgatcgacctggccctgatcgaaaaagcggcctacgagatcggc
tacgaggccgcgcaccgtcccgattgggtatgcattccactgaacggcctggccacgctg
gcggaccgcttgttgtccagcgaaaccgcttcgggccagacgcccgccaacgcagaatag

DBGET integrated database retrieval system