KEGG   Bordetella flabilis: BAU07_11115Help
Entry
BAU07_11115       CDS       T04592                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bfz  Bordetella flabilis
Pathway
bfz03030  DNA replication
bfz03410  Base excision repair
bfz03420  Nucleotide excision repair
bfz03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bfz00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BAU07_11115
   03410 Base excision repair
    BAU07_11115
   03420 Nucleotide excision repair
    BAU07_11115
   03430 Mismatch repair
    BAU07_11115
Enzymes [BR:bfz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BAU07_11115
    6.5.1.6  DNA ligase (ATP or NAD+)
     BAU07_11115
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BAU07_11115
DNA replication proteins [BR:bfz03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BAU07_11115
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BAU07_11115
DNA repair and recombination proteins [BR:bfz03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BAU07_11115
   NER (nucleotide excision repair)
    Other NER factors
     BAU07_11115
   MMR (mismatch exicision repair)
    Other MMR factors
     BAU07_11115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ANN77583
UniProt: A0A193GD84
LinkDB All DBs
Position
2546107..2547750
Genome map
AA seq 547 aa AA seqDB search
MKAFADLYAKLDATTSSNAKLAAMQDYFRTAPAADGAWAAYFLAGGKPRQLVPTKVLRQF
ITETAGIPEWLFEESYQAVGDLAETLALLLPDPGTEDQAGLAEWVEERLLPLRGLPPAEI
LHRLSDLFGRLDAHGRFVCAKLMTGAMRVGVSKLLLTRALAEVAGVDARHMAQRLIGYTD
IGARPQSDAFTHLLAPLSHDAQARADGHPYPFFLAHPLSADPAAFQDLLGPPARWQVEWK
WDGIRAQVVRRAEQTWVWSRGEELVTERFPELMRLGTHLPEGTVLDGEIVVWREGRVQPF
ALLQQRLGRKTVGAKLLADAPVVLLTYDLLELDGQDMRSQPQSARRAALEQLAFRVHDPA
LELSPLLHGDDWQDLARQREASRALGVEGMMLKAADARYGVGRTKESGVWWKWKVDPFSV
DAVLIYAQRGHGRRASLYTDYTFAVWDGPPDAPERRLVPFAKAYSGLTDEEIRKVDAIVR
KTTVEKFGPVRSLEPTQVFELGFEGIARSGRHKSGIAVRFPRMLRWRQDKTPADADSLET
LAALLPE
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccttcgcggacctgtatgcaaagctggatgccaccacttccagcaacgccaaa
cttgctgccatgcaggactacttccgcacggcgccggcggcggatggcgcctgggccgcc
tatttcctggccggcggcaagccgcgccaactggtcccgaccaaggttctgcggcagttc
ataaccgagacggccggcatcccggaatggctgttcgaggaaagctaccaggccgtcggc
gatctcgcggagacgctggcgctgttgctgcccgatccgggcacggaggaccaggcgggg
cttgccgagtgggtggaagaacgcctgctgccgttgcgcggcctgccaccggcagaaatc
ctgcatcgcctaagcgatctgttcggccggctggatgcacacgggcgttttgtctgcgcc
aagctgatgaccggtgccatgcgggtcggggtatcgaagctcctgctgacgcgtgccctg
gcagaggtcgccggcgtcgacgcccgccatatggcgcagcgcctgatcggctacaccgat
atcggggcgcgtccgcagtccgatgcgttcacgcatttgttggcgcctttgtcgcacgac
gcccaggcgcgcgcggacggccacccctatccgttcttccttgcgcatccgctgtccgcc
gacccggcggcgttccaggatctgctcggcccgccggcgcgttggcaggtcgaatggaaa
tgggatggcatccgcgcccaggtggtgcggcgcgccgaacagacctgggtctggtcgcgt
ggcgaggaactggtcaccgagcgctttcccgagctgatgcggctcggcacccacttgccg
gaaggcacggtcctggatggcgagatcgtggtctggcgcgagggcagggtgcaacccttc
gcgctgcttcagcagcgcctcgggcgtaaaacggtgggcgcgaaattgctggccgacgcg
ccggtggtgctgcttacctacgacttgctggagctcgacggccaggacatgcgctcgcaa
ccgcagtctgcccggcgcgcggcgctggaacagttggccttccgggtgcatgaccccgcg
ctggagctgtcgccgctgctgcacggcgatgattggcaggacctggcccggcaacgcgaa
gcgtcccgcgcgttgggcgtcgaaggcatgatgctcaaggccgccgacgcccgctacggg
gtggggcgcaccaaggaaagtggcgtctggtggaaatggaaagtcgatccgttttccgtg
gacgcggtattgatctacgcgcaacgcggacacgggcgtcgcgccagcctctatacggat
tacacgtttgccgtctgggacggccccccggacgcacccgagcgccggctggtgccgttc
gccaaggcgtattccggcctgaccgacgaggagatccgcaaggtcgacgccatcgtgcgc
aagaccacggtggagaagttcgggccggtgcgcagcctggagcccacccaggtcttcgaa
ctcgggttcgaaggcatcgcccgcagtggccggcacaagagcggtatcgcggtgcggttt
ccccgcatgctgcgttggcgccaggacaagacgccggccgatgcggacagccttgagacg
ctggcggctttgctgccggagtag

DBGET integrated database retrieval system