KEGG   Bordetella flabilis: BAU07_15055Help
Entry
BAU07_15055       CDS       T04592                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bfz  Bordetella flabilis
Pathway
bfz00061  Fatty acid biosynthesis
bfz00780  Biotin metabolism
bfz01100  Metabolic pathways
bfz01212  Fatty acid metabolism
Module
bfz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BAU07_15055
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAU07_15055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bfz01004]
    BAU07_15055
Enzymes [BR:bfz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BAU07_15055
Lipid biosynthesis proteins [BR:bfz01004]
 Fatty acid synthase
  Component type
   BAU07_15055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: ANN78241
UniProt: A0A193GFM1
LinkDB All DBs
Position
complement(3430265..3430717)
Genome map
AA seq 150 aa AA seqDB search
MELDIKGILARLPHRYPMLLIDRVIDIQPGKSIVALKNVSINEPFFTGHFPHHPVMPGVL
ILEAMAQAAALFSFSDEAALKNEESSTVYYFVGIDGARFRRPVVPGDQLRIEVDAERLSR
TICKYAGRAVVDGQLVAEAKLMCAIRSLEA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggaattggacattaaggggatcctggctcgtttgccgcatcgatatccgatgctgctg
atcgaccgcgtgatcgacatccagccgggcaagtccatcgtcgccctcaagaacgtatcg
atcaacgaaccgttcttcacgggacactttccgcatcacccggtcatgccgggggttctg
atcctggaagccatggcccaggccgcggcgctgttctcgttttcggacgaggcggctctg
aagaacgaggaatcgtccacggtgtattacttcgtgggcatcgatggcgcgcgtttccgt
cgtcccgtcgtgccgggagaccagttacgcatcgaagtcgacgcggaacggttgagccgc
accatctgcaagtatgccggccgtgccgtcgtcgatggccagctcgtcgccgaagccaaa
ctcatgtgtgccatccgcagcctggaagcataa

DBGET integrated database retrieval system