KEGG   Bordetella flabilis: BAU07_25230Help
Entry
BAU07_25230       CDS       T04592                                 

Definition
(GenBank) gamma carboxymuconolactone decarboxylase
  KO
K01607  4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
bfz  Bordetella flabilis
Pathway
bfz00362  Benzoate degradation
bfz01100  Metabolic pathways
bfz01120  Microbial metabolism in diverse environments
bfz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAU07_25230
Enzymes [BR:bfz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     BAU07_25230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD ATP-cone
Motif
Other DBs
NCBI-ProteinID: ANN79976
UniProt: A0A193GKN7
LinkDB All DBs
Position
complement(5662144..5662539)
Genome map
AA seq 131 aa AA seqDB search
MANDELFEKGFQNRKDVLGAAHVEKSWNSADDFNRPMQKLVTEYCWGEIWSDPTLPFKTR
SLINLAMLTAMSQHHELAAHVKGALRNGVTKDEIRAVLMQAAIYCGVPLALAAFRVASEA
IAAYEAEAARG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgacgaacttttcgagaagggtttccagaaccgcaaggacgtgctcggcgcg
gcgcatgtcgaaaaatcctggaactcggcggacgatttcaaccgccccatgcagaaactc
gtcaccgagtactgctggggcgagatatggagcgatcccacgctgccgttcaagacgcgc
agcctgatcaacctggccatgctcacggcgatgagccagcaccacgaactggccgcgcat
gtgaaaggcgccttgcgtaacggcgtcaccaaggacgagatccgcgcggtgctgatgcag
gccgccatctattgcggcgtgcccttggcgctggctgccttccgcgtggcgagcgaggcc
attgccgcctatgaagccgaggccgcgcgcggctga

DBGET integrated database retrieval system