KEGG   Bordetella flabilis: BAU07_25965Help
Entry
BAU07_25965       CDS       T04592                                 

Definition
(GenBank) methionine ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
bfz  Bordetella flabilis
Pathway
bfz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BAU07_25965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bfz02000]
    BAU07_25965
Transporters [BR:bfz02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BAU07_25965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21
Motif
Other DBs
NCBI-ProteinID: ANN80101
UniProt: A0A193GL15
LinkDB All DBs
Position
5818565..5819578
Genome map
AA seq 337 aa AA seqDB search
MTTTNVQPVPAAAPAPILDVVGLQTHFFTRAGVAKAVDGVDLRLQAGEILGLVGESGSGK
SITGFSLIGLVDEPGRVVGGSIRFDGRELREATPEQMRALRGNDIAMIFQDPMMTLNPVL
RVDTQMIEAIQAHSNMATAAARARARDVLAMVGIPSPEERLRAYPHQLSGGMRQRVAIAI
ALLNGPRVIIADEPTTALDVTIQGQILYEVQKLCRETGTALLWITHDLAVVSGLADRIAV
MYAGRVVETGTTQDVIGRPLHPYTHGLMRSIPTPDTRGHDLASIPGMTPSLLKLPEGCAF
RTRCPRATDACLRAPESVEWQPGHWVRCWHAGEREAR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacgaacgtccagcccgtcccggctgccgcgccggcgcccattctcgacgta
gtgggcctgcagacgcactttttcacgcgcgccggcgtggccaaggccgtggacggcgtg
gacctgcggctgcaggccggtgaaatcctgggactggtcggcgagtcgggttccgggaaa
agcattaccggcttttcgctgatcggcctggtggacgaacccggccgtgtggtgggagga
tcgatacgcttcgatggccgtgaactgcgcgaggcgacgccggagcagatgcgggccttg
cgcggcaacgatatcgccatgatcttccaggatccgatgatgacgttgaacccggtcctg
cgggtcgatacgcagatgatcgaagccatccaggcgcactccaacatggccaccgccgca
gcgcgtgcgcgtgcgcgcgacgtgctggccatggtcggcatcccttcgccggaagaacgc
ctgcgcgcctatcctcatcagttgtccggcggcatgcggcaacgcgtggccatcgccatc
gccttgttgaacggaccgcgcgtcatcatcgcggacgaacccaccacggcgctggacgtc
accatccagggccagatcctgtacgaggtacagaaactgtgccgggaaaccggtacggcc
ctgctgtggatcacccacgacctggcggtggtatcgggcctggccgaccgcatcgcggtg
atgtacgcgggccgcgtggtggagaccggcacgacgcaggatgtcatcggacgtccgttg
catccctatacccacgggctcatgcggtccattccgacccccgacacgcgcggccatgac
ctggcctccatcccgggcatgacaccctccctgctgaagctgcccgaaggctgtgccttc
cgcacgcgctgcccgcgtgccaccgacgcctgtctgcgcgcgcccgaatccgtggagtgg
cagcccggccactgggtgcgctgttggcacgccggcgaacgggaggcgcgatga

DBGET integrated database retrieval system