KEGG   Borreliella bavariensis PBi: BG0245Help
Entry
BG0245            CDS       T00194                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bga  Borreliella bavariensis PBi
Pathway
bga00564  Glycerophospholipid metabolism
bga01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BG0245 (glpA)
Enzymes [BR:bga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BG0245 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AAU07099
UniProt: Q662C2
LinkDB All DBs
Position
247316..248884
Genome map
AA seq 522 aa AA seqDB search
MNNNKETKLKDLENQEFDLIIIGGGATGLGIAVDAITRGYKAILIEKFDYAKGTSSRSSK
LIHGGVRYLAQWNISLVKEALHEKAILEKNAPHLINECAFITPIYNILEIPYYYLGLTYY
HNLMGKEKATKYKTKLLSKKSTIEKATNIKTKGLKCSVLYYDDSFDDARMAITLLRTFTE
KGGIALNYTELVQFNKENGKLSGVLIQNKLSKEQISLKSKCIINATGIFSDEIRRLDDEK
ALNIIKPSQGSHLIIKKDKFPQNYAILIPKTSDNRILFAIPWYDGVVCGSTDIPIKEIEV
EPKRLDEEIDFIINNLNNYLNIKIEKSDVKSVYTGIRPLIMDPKVEGNTSKISRNEKIFI
SDSNLITIAGGKYITYRKMAEKTLLKAIEKNLLPNYPPTTENLKLHGYLKKEEAVKIPES
FRTYGSDFEILKNMEGFDKKIHESLDLNEAQIAFSIEFEQAKTIDDVLARRTRSLPLNPQ
AAIEAAPRVAEIMMKKLNKSEKWKNEQIKTFLEISKKYLIKN
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaataataacaaagaaacaaaattaaaagatcttgaaaatcaagaatttgatctcata
ataattggaggaggcgcaacaggtcttggtatcgcagtagatgcaatcacaaggggatat
aaagcaatacttatagaaaaatttgactacgcaaaaggaacttcctctagatcaagcaaa
ttaattcacgggggagtaagatatttagctcaatggaatatttctttggttaaagaagcc
ttacatgaaaaagcaattcttgaaaaaaatgcacctcatttaattaacgaatgtgcattt
attacccctatttataatatcttagaaataccttattattatctgggattaacttattac
cacaatcttatgggcaaagaaaaagctaccaaatataaaactaaattactatccaaaaaa
tctaccattgaaaaagctactaatattaaaacaaaaggccttaaatgctctgttttatat
tacgatgattcattcgatgatgctagaatggcaataacattattaagaacttttaccgaa
aaaggaggaattgcccttaactacacagagcttgtacaatttaacaaggaaaacggaaaa
ctttcaggggttttaatacaaaataaattgtcaaaagaacaaatttcattaaaaagtaaa
tgtataataaacgcaacaggaatattttcagatgaaataagaagattggatgatgaaaaa
gctttaaacattatcaaaccttcccaaggtagccatttaataatcaaaaaagacaaattc
ccccaaaattatgcaatattaatacctaaaactagtgataatagaattttattcgctatt
ccttggtatgatggcgttgtttgtggaagtaccgacattccaataaaagagatagaagta
gagcccaaaagacttgatgaggagattgactttataataaataatttaaacaattattta
aatattaaaatagaaaaatcagatgtaaaaagcgtatatactggaataagacccttaata
atggatccaaaagtcgaaggcaacacttcaaaaatttcaagaaacgaaaaaatatttata
tcagattcaaatcttattacaatagcgggaggcaaatatattacatatagaaaaatggca
gaaaaaaccttgctcaaagccatagaaaaaaatttattaccaaattatccaccaactaca
gaaaatttaaagttacacggctatcttaaaaaagaagaggcagtaaaaattcctgaatct
tttagaacttatggtagtgactttgaaattctaaaaaatatggaagggtttgacaaaaag
atacacgagagcttagatttaaatgaagctcaaatagctttttcgattgaatttgaacaa
gccaaaactattgacgatgttttagcaagaagaacaagatcgttgcctttaaatcctcaa
gctgcaattgaagctgccccaagggttgctgaaataatgatgaaaaaattaaataaatct
gaaaagtggaaaaatgaacaaataaaaacctttttagaaataagcaaaaaatatttaatt
aaaaattaa

DBGET integrated database retrieval system