KEGG   Borreliella bavariensis PBi: BG0668Help
Entry
BG0668            CDS       T00194                                 

Gene name
ptsG
Definition
(GenBank) PTS system, glucose-specific IIBC component
  KO
K02778  PTS system, glucose-specific IIB component [EC:2.7.1.199]
K02779  PTS system, glucose-specific IIC component
Organism
bga  Borreliella bavariensis PBi
Pathway
bga00010  Glycolysis / Gluconeogenesis
bga00520  Amino sugar and nucleotide sugar metabolism
bga01100  Metabolic pathways
bga02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BG0668 (ptsG)
   00520 Amino sugar and nucleotide sugar metabolism
    BG0668 (ptsG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BG0668 (ptsG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bga02000]
    BG0668 (ptsG)
Enzymes [BR:bga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.199  protein-Npi-phosphohistidine---D-glucose phosphotransferase
     BG0668 (ptsG)
Transporters [BR:bga02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    BG0668 (ptsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_EIIB Phage_holin_2_1
Motif
Other DBs
NCBI-ProteinID: AAU07496
UniProt: Q660M5
LinkDB All DBs
Position
685344..686888
Genome map
AA seq 514 aa AA seqDB search
MVKGFEQAQKFGRSFMLPIAILPAAGLLLGIGGSLSNPETVKSYSFLDIFFLQSVFKIMS
ASGSIIFSNLAPIFSIGVAVGLAKSDRGTAGIAAFIGYLVMNATIGVLIDMSGKAESLSS
GAVGLILGIKTLETGVFGGVVVGILTYYLHSRFNKVDLPKALGFFSGSRFVPIIVSFSSI
FLAVIMFIFWPFVQNGINKVGGLVDSTGYIGTLIFGIFLRMLGPFGLHHIFYLPFWTTGL
GGSVIIDGKLIEGTQNIFFAELASQGTSRFFVGTSRFMSGRFITMMFGLPGAALALYYTA
KYDERTKVFGLLMSAALTSFLTGITEPLEFSFLFVAPILYIVHATFDGFAFMLAHILQIT
IGQTFSGGFIDFILFGILQGNSRTNWLLVPVVGTVWFFLYYFTFVFLINKFDFKTPGRTQ
DLNSGDSPNSKSSEFEENYATKVIIGLGGASNIVELDCCAPRLRVTVRDALKVSEKILKK
TGSKGVIIKGNGVQVVYGPGVSVLKNEIEELLDD
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagggttttgaacaagctcaaaaatttgggcgttctttcatgcttcccattgct
attttgccagcagcagggttgcttttaggaattggaggctctctttctaatccggaaact
gttaagtcgtattcttttttagatatatttttcttacaatcagttttcaagataatgagt
gcatcaggttctattattttttcgaatttagcgccaatattttctattggggttgctgtt
gggcttgccaagtcagataggggtacagctggaattgcagcatttattggttaccttgta
atgaatgctactattggggttttaattgatatgtcgggcaaagcagagtctctttctagc
ggtgctgtgggtttgattcttggaattaagacgttagaaacaggggtttttggcggagtt
gtagttggtattttgacctattatcttcattctaggtttaacaaggtagatttacccaag
gctcttgggtttttttcgggatccagatttgtgccgattattgtgtctttttctagtatt
tttcttgctgtaattatgtttattttttggccatttgtacaaaatggaattaataaagta
ggaggcttggtagattcaaccggctatatcggaacacttatttttggaatttttttaaga
atgcttggaccttttggcctgcatcacatattttatttaccattttggacaacaggcctt
gggggatctgttattattgatggaaagttgattgaagggactcaaaatatcttctttgca
gaacttgcttctcaaggtacaagtagattttttgttggaactagtcgttttatgagtgga
cgatttattactatgatgtttggtttgccaggagccgcacttgcgctatactacaccgca
aagtatgatgagagaacaaaagtttttggtcttttaatgtctgcagccctaacatcattt
ttaacaggcataacagagcctcttgaattttcttttctgttcgtagctcctattctttat
attgttcatgctacatttgatggatttgcttttatgctggcgcatattcttcaaattaca
ataggtcaaacattttctggggggtttattgattttattctttttggtattttgcagggg
aattcaagaactaattggcttttggtgccagttgtaggcactgtttggtttttcctttat
tactttacttttgtatttttaataaataaatttgattttaaaacccctggtagaacgcaa
gatttaaattctggagattctccaaattctaagagtagtgaattcgaagaaaattatgct
actaaggttattattgggcttggcggtgcttcaaatattgttgagcttgattgttgtgca
cccaggttaagagttacagtaagagatgctcttaaagtttctgaaaaaattttaaaaaaa
accggttccaaaggagtaattattaaaggtaatggggttcaggttgtttatggaccaggt
gttagcgttcttaaaaatgaaatagaagaattgctagatgattga

DBGET integrated database retrieval system