KEGG   Borreliella garinii BgVir: KK9_0247Help
Entry
KK9_0247          CDS       T02048                                 

Gene name
glpA
Definition
(GenBank) GlpA
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bgb  Borreliella garinii BgVir
Pathway
bgb00564  Glycerophospholipid metabolism
bgb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KK9_0247 (glpA)
Enzymes [BR:bgb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KK9_0247 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEW68583
LinkDB All DBs
Position
linear:247417..248985
Genome map
AA seq 522 aa AA seqDB search
MNNNKETKLKDLENQEFDLIIIGGGATGLGIAVDAITRGYKAILIEKFDYAKGTSSRSSK
LIHGGVRYLAQWNISLVKEALHEKAILEKNAPHLINECAFITPIYNILEIPYYYLGLTYY
HNLMGKEKATKYKTKLLSKKSTIEKAPNIKTEGLKCSVLYYDDSFDDARMAITLLRTFTK
KGGIALNYTELVQFNKENGKLSGVLIQNKLSKEQISLKSKCIINATGIFSDEIRRLDDEK
ALNIIKPSQGSHLIIKKDKFPQNHAILIPKTSDNRILFAIPWYDGVVCGSTDIPIKEVEV
EPKRLDEEIDFIINNLNNYLNIKIEKSDVKSVYTGIRPLIMDPKAEGNTSKISRNEKIFI
SDSNLITIAGGKYTTYRKMAEKTLLKAIEKKLLPNYPPTTEDLKLHGYLKKEAAVKIPEP
FRTYGSDFEILKNMEGFDKKIHESLDLNEAQIAFSIEFEQAKTIDDVLARRTRSLPLNPQ
AAIEAAPRVAEIMMKKLNTSEKWKNEQIKTFLEISKKYLIKN
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaataataacaaagaaacaaaattaaaagatcttgaaaatcaagaatttgatctcata
ataattggaggaggcgcaacaggtcttggtatcgcagtagacgcaatcacaaggggatat
aaagcaatacttatagaaaaatttgactacgcaaaaggaacttcctctagatcaagcaaa
ttaattcacggtggagtaagatatttagctcaatggaatatttctttggttaaagaagct
ttacatgaaaaagcaattcttgaaaaaaatgcacctcatttaattaacgaatgtgcattt
attacccctatttataatatcttagaaataccttattattatttgggattaacttattac
cacaatcttatgggtaaagaaaaagctaccaaatataaaactaaattactatccaaaaaa
tctaccattgaaaaagctcctaatattaaaacagagggccttaaatgctctgttttatat
tacgatgattcattcgatgatgctagaatggcaataacattattaagaacttttaccaaa
aaaggaggaattgcccttaactacacagagcttgtacaatttaacaaggaaaacggaaaa
ctttcaggggttttaatacaaaataaattgtccaaagaacaaatttcattaaaaagtaaa
tgtataataaacgcaacaggaatattttcagacgaaataagaagattggatgatgaaaaa
gctttaaacatcatcaaaccttcccaaggtagccatttaataatcaaaaaagacaaattc
ccccaaaatcatgcaatactaatacctaaaactagtgataataggattttattcgctatt
ccttggtatgatggcgtcgtttgtggaagtaccgacattccaataaaagaggtagaagta
gagcccaaaagacttgatgaagagattgactttataataaataatttaaacaattattta
aatattaaaatagaaaaatcagatgtaaaaagcgtatatactggaataagacccttaata
atggatccaaaagccgaaggcaacacttcaaaaatttcaagaaacgaaaaaatatttata
tcagattcaaatcttattacaatagcgggaggcaaatatactacatatagaaaaatggca
gaaaaaaccttgctcaaagccatagaaaaaaaattattaccaaattatccaccaactaca
gaagatttaaagttacacggctatcttaaaaaagaagcggcagtaaaaattcctgaacct
tttagaacttatggtagtgactttgaaattctaaaaaatatggaagggtttgacaaaaag
atacacgagagcttggatttaaatgaagctcaaatagccttttcgattgaatttgagcaa
gccaaaactattgacgatgttttagcaagaagaacaagatcgttacctttaaatccccaa
gctgcaattgaagctgccccaagggttgctgaaataatgatgaaaaaattaaatacatct
gaaaagtggaaaaatgaacaaataaaaacctttttagaaataagcaaaaaatatttaatt
aaaaattaa

DBGET integrated database retrieval system