KEGG   Borreliella garinii CIP 103362: BLA33_03085Help
Entry
BLA33_03085       CDS       T04731                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bgc  Borreliella garinii CIP 103362
Pathway
bgc00564  Glycerophospholipid metabolism
bgc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BLA33_03085
Enzymes [BR:bgc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BLA33_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 Pyr_redox_3 GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: APQ15316
LinkDB All DBs
Position
complement(656519..658027)
Genome map
AA seq 502 aa AA seqDB search
MNNNKETKLKDLENQKFDLIIIGGGATGLGIAVDAITRGYKTILIEKFDYAKGTSSRSSK
LIHGGVRYLAQWNISLVKEALHEKAILEINAPHLINECAFITPIYNILEIPYYYLGLTYY
HNLMGKEKATKYKTKLLSKKSTIEKAPNIKREGLKCSVLYYDDSFDDARMAITLLRTFTE
KGGIALNYTELVQFNKENGKLSGVLIQNKLSKEQISLKSKCIINATGIFSDEIRRLDDEK
ALNIIKPSQGSHLIIKKDKFPQNHAILIPKTSDNRILFAIPWYDGVVCGSTDIPIKEVEV
EPKRLDEEIDFIINNLNNYLNIKIEKSDVKSVYTGIRPLIMDPKAEGNTSKISRNEKIFI
SDSNLITIAGGKYTTYRKMAEKTLLKAIEKNLLPNYPPNTEDLKLHGYLKKEETIKIPEP
FRTYGSDFEILKNMEGFDKKIHESLDLNEAQIAFSIEFEQAKTIDDVLARRTRSLPLNPQ
AAIEAAPRVAEIMMKKLNESEK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaataataacaaagaaacaaaattaaaagatcttgaaaatcaaaaatttgatctcata
ataattggaggaggcgcaacaggtcttggtatcgcagtagacgcaatcacaaggggatat
aaaacaatacttatagaaaaatttgactacgcaaaaggaacttcttctagatcaagcaaa
ttaattcacggtggagtaagatatttagctcaatggaatatttctttggttaaagaagct
ttacatgaaaaagcaattcttgaaataaatgcacctcatttaattaacgaatgtgcattt
attactcctatttataatatcttagaaataccttattattatttgggattaacttattac
cacaatcttatgggcaaagaaaaagctaccaaatataaaactaaattactatccaaaaaa
tctaccattgaaaaagctcctaatattaaaagagaaggccttaaatgctctgttttatat
tacgatgattcattcgatgatgctagaatggcaataacattattaagaacttttaccgaa
aaaggaggaattgcccttaactacacagagcttgtacaattcaacaaggaaaacggaaaa
ctttcaggggttttaatacaaaataaattgtcaaaagaacaaatttcattaaaaagtaaa
tgtataataaacgcaacaggaatattttcagatgaaataagaagattggatgatgaaaaa
gctttaaacattatcaaaccttcccaaggtagccatttaataatcaaaaaagacaaattc
ccccaaaatcatgcaatattaatacctaaaactagtgataatagaattttattcgctatt
ccttggtatgatggcgttgtttgtggaagcaccgacattccaataaaagaggtagaagta
gagcccaaaagacttgatgaagagattgactttataataaataatttaaacaattattta
aatattaaaatagaaaaatcagatgtaaaaagcgtatatactggaataagacccttaata
atggatccaaaagccgaaggcaacacttcaaaaatttcaagaaacgaaaaaatatttata
tcagattcaaatcttattacaatagcggggggcaaatatactacatatagaaaaatggca
gaaaaaaccttgctcaaggccatagaaaaaaatttattaccaaattatccaccaaataca
gaagatttaaagttacacggctatcttaaaaaagaagagacaataaaaattcctgaacct
tttagaacttatggtagtgactttgaaattctaaaaaatatggaagggtttgacaaaaag
atacacgagagcttggatttaaatgaagctcaaatagccttttcgattgaatttgagcaa
gccaaaactattgacgatgttttagcaagaagaacaagatcgttgcctttaaatccccaa
gctgcaattgaagctgccccaagagttgctgaaataatgatgaaaaaattaaatgaatct
gaaaagtag

DBGET integrated database retrieval system