KEGG   Burkholderia gladioli BSR3: bgla_1g01120Help
Entry
bgla_1g01120      CDS       T01464                                 

Definition
(GenBank) Aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00010  Glycolysis / Gluconeogenesis
bgd00620  Pyruvate metabolism
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bgla_1g01120
   00620 Pyruvate metabolism
    bgla_1g01120
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     bgla_1g01120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEA58813
UniProt: F2LH86
LinkDB All DBs
Position
1:complement(123031..124551)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQHLNIEFPYRKQYGNFIGGEWVPPVDGQYFDNLSPVTGQAFTAIPRSQEADINL
ALDAAHKAKASWGATPVAERAAVLLRIADRMEQNLARLAVAETIDNGKPLRETTAADIPL
AIDHFRYFAGCVRAQEGSIADIGGDLVAYHFHEPLGVVGQIIPWNFPILMAAWKIAPALA
AGNCVVLKPAEQTPASILVWAELVQDLLPPGVLNIVNGFGLEAGKPLASSKRISKIAFTG
ETTTGRLIMQYASANLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYDRFIERAVKRVEKIRQGHPLDAQTMIGAQASAEQLEKILSYIDIGR
QEGAECLTGGERNTLTGELASGYYVKPTVFRGHNKMRIFQEEIFGPVLSVTTFKNEDEAL
EIANDTLYGLGAGVWTRDGGRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYDDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgccgagatgcagcacctgaacatcgaattcccgtaccgcaagcaatacggg
aacttcatcggcggcgaatgggtgccccctgtcgacggccagtacttcgacaatctctcg
cccgtcaccggccaggccttcaccgcgatcccgcgctcgcaggaagccgacatcaacctc
gcgctggacgccgcgcacaaggccaaggcgagctggggcgcgaccccggtggccgagcgc
gccgccgtgctgctgcgcatcgccgatcgcatggagcagaacctggcgcgcctggcggtg
gccgagaccatcgacaacggcaagccgctgcgcgagaccaccgcggccgacatcccgctc
gcgatcgaccatttccgctacttcgcgggctgcgtgcgcgcccaggaaggctcgatcgcc
gacatcggcggcgacctggtggcctatcacttccacgagccgctcggcgtggtcggccag
atcatcccctggaacttcccgatcctgatggcggcctggaagatcgcgccggcgctggcg
gccggcaactgcgtggtgctcaagccggccgagcagacgccggcctcgatcctggtgtgg
gccgagctggtccaggacctgctgccgccgggcgtgctcaacatcgtcaacggcttcggg
ctggaagccggcaagccgctggcatccagcaaacggatctcgaagatcgccttcaccggc
gagaccaccaccggccgcctgatcatgcagtacgccagcgcgaacctgatcccggtcacg
ctcgagctgggcggcaagagcccgaacatcttcttcgccgacgtgatggaccgcgacgac
agctacttcgacaaggccctggaaggcttcgcgatgttcgcgctgaaccagggggaggtg
tgcacctgcccgtcgcgcgcgctggtcgaggaaagcatctacgaccgcttcatcgagcgc
gccgtcaagcgcgtcgagaagatccgccagggccacccgctcgacgcgcagaccatgatc
ggcgcgcaggcctcggccgagcagctcgagaagatcctgtcctatatcgacatcggccgc
caggaaggcgccgagtgcctgacgggcggtgagcgcaacacgctgacgggcgagctcgcc
agcggctactacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaggagatcttcgggccggtgctgtcggtgaccaccttcaagaacgaggatgaggcgctg
gagatcgccaacgacacgctctacgggctcggcgccggcgtgtggacgcgcgacggcggc
cgcgcctatcgcttcggccgcgcgatccaggccggccgcgtgtggaccaactgctatcac
gcctatccggcgcatgccgcgttcggcggctacaagcagtcggggatcggccgcgagacg
cacaagatgatgctcgaccattaccagcagaccaagaaccttctggtcagctacgacgac
aagccgctcggcttcttctga

DBGET integrated database retrieval system