KEGG   Burkholderia gladioli BSR3: bgla_1g04060
Entry
bgla_1g04060      CDS       T01464                                 

Definition
(GenBank) OmpA family protein, putative
  KO
K11892  type VI secretion system protein ImpK
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    bgla_1g04060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_1g04060
Secretion system [BR:bgd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bgla_1g04060
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AEA59099
UniProt: F2LI22
LinkDB
Position
1:complement(446062..446847)
AA seq 261 aa
MSYAPSLFGGTTPPPAPHSASSTDASFQARSLLDLLYDGFFMMFLLKNGREPGEANEFRT
RIQEFLADFERGAKKLNAGADDVYAAKFAFCAAIDEAVLSSQFKVRAEWERRPLQLVLFG
EQLAGEKFFQYLEECRAHGVARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARIGDEI
AQMKGKRAPFAPHWALPDQIAHRLKREVPLWAIGAVFALVGLLAFVGLNAYLRDHTLKAL
APYSQIIKVGPESANLTISLP
NT seq 786 nt   +upstreamnt  +downstreamnt
atgagctacgcgccctccctgttcggcggcaccacgccgccccccgccccgcattcggcc
tcgtcgaccgacgccagcttccaggcgcgctcgctgctcgacctgctctatgacggcttc
ttcatgatgttcctgctgaagaacggtcgcgagcccggcgaggcgaacgagttccgcacg
cggatccaggagttcctggccgatttcgagcgcggcgcgaagaagctcaatgccggcgcc
gacgacgtctacgccgccaagttcgcgttctgcgcggcgatcgacgaggcggtgctgtcc
tcgcagttcaaggtgcgtgccgagtgggagcgccgcccgctgcagctggtgctgttcggc
gagcaactggccggcgagaagttcttccagtacctggaggaatgccgcgcgcacggcgtg
gcgcgcctgcagtcgctggaggtgttccacatgtgcctgctgctgggcttccagggcaag
tacctgctcgagggaccggagaagctcgcctacctgaccgcgcggatcggcgacgagatc
gcccagatgaagggcaagcgcgcgcccttcgcgccgcattgggcgctgcccgaccagatc
gcgcaccgcctcaagcgcgaggtgccgttgtgggcaatcggcgccgtgttcgcgctggtc
ggcctgctggccttcgtcgggctcaacgcctatctgcgcgatcacacgctgaaggcgctg
gcgccctattcgcagatcatcaaggtcgggccggaatcggccaacctgacgatctcgctg
ccctga

DBGET integrated database retrieval system