KEGG   Burkholderia gladioli BSR3: bgla_1g04200
Entry
bgla_1g04200      CDS       T01464                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    bgla_1g04200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_1g04200
Secretion system [BR:bgd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bgla_1g04200
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C MMR_HSR1
Other DBs
NCBI-ProteinID: AEA59113
UniProt: F2LI36
LinkDB
Position
1:complement(462305..466180)
AA seq 1291 aa
MQRILNVLTHPRTLSILGFIALAAILFIVADALAISFVYPLAILAVIVVLWLLVKLIKRL
RVRRANRKLGDMLEEQAQVDKAAAASVTPVEPAKAAELDTLRARLVDTVKTIKTSKIGQV
SGGSALYELPWYIVIGNPAAGKSSAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEG
ILLDTAGRYSVHEEDRSEWIGFLGLLKKFRPKAPINGIIVTASIAELTGSRPEFAINLAK
NLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSSDRQEYDRVWGATLPYEPDEKR
DVVALFDERFEELYDGLKEISVAQLSISRGNILSPGQLSFPLEFASIKPTLRAFLATLFE
NNPFQYKPIFRGFYFTSALQEGETNSAAAQRIASRFALDGSALPKPHSAFSKNGFFLRDL
FSKVIFEDRKTVRQFASPAKTRMRYATFFAFVAVLALALGGWTWSTIGNQQLVANVQADL
DNIAKLEQNRNDLQSRLQAMDILEDRIEQLEQFRRDKPLSVSLGLYQGDRLEERLLTEYY
NGVRQIMLAPVADNLAAFLKDVDAHPDQLAPMTRTPESGAVPVSDKSALQPQAQGGLYND
ASPTNVEDAYNALKTYLMLSDKRHVEQAHLTDQIARFWRGWLETNRGNMPRDEMIRSAER
MITFYLSRVQDNDWPMIDANLALVDQTRENLRHVVRGMPARQRVYEEIKARASTRYAPMT
IARIVGEDNTGLVAGSYAIPGTFTRDAWFDYVQPAIRDAATKELQAKDWVLNTASQDDLT
LEGSPEQIQKVLVGMYKTEYAQHWQKFMQGIAVQNFGSFGQAVDAMNKLGDPQDSPIRKV
LETAYDQTSWDNPSLANVSIKKAQTGVVNWVKQWFSRKPGGQLAANIDINGNPVEVPMGP
IGQEFIGLGRIVQTHDGGQSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGN
GSELADSLKYVDEQMLTGLTDSQRKSLRPLLVRPLQQAFSVVIQPASVEVNKVWNAQVYQ
PFQASLANKYPFSAGAKVEAASSEIAQVFGPDGSISKFVGTTLGPLAVRRGDTLTARTWG
DMGLALTPEFTSGFATWVAPLAGGAATSAASSEPQTVFQILPQPSSGTTEYTIAIDGQQL
RYRNTPPQWTNFVWPNPSGSPGATLTATTFDGRTLTLVNEPGRYGLEKLINSAQRSRRPD
GTFDLAWTQGNVNVAVTMRIISTSQPSGGGSGGGDAPQQQSLRGLHLPSSVANTSASGAV
NATAQAPAGTSGVATAANGAAANASNAQGAQ
NT seq 3876 nt   +upstreamnt  +downstreamnt
atgcaacgcatcctcaacgtgttgactcacccgcgcacgctctcgatcctcgggttcatc
gcgctcgccgcgatcctgttcatcgtggcggacgcccttgcgatcagcttcgtctacccg
ctcgcgatcctcgcggtgatcgtggtgctgtggctgctggtgaagctgatcaagcggctg
cgcgtgcggcgcgccaaccgcaagctcggcgacatgctcgaggagcaggcccaggtcgac
aaggcggcggccgcctcggtgacgccggtcgaaccggccaaggccgccgagctcgacacg
ctgcgcgcgcgcctggtggacacggtcaagaccatcaagacctcgaagatcggccaggta
tccggcggctcggcgctctacgagctgccctggtacatcgtgatcggcaacccggcggcg
ggcaagagcagcgcggtgatcaactcgggcctgcagttcccgttcgccgacaagaacagc
gcggtgatccacggcatcggcggcacccgcaactgcgactggttcttcaccaccgagggc
atcctgctcgacaccgccggccgctactcggtgcacgaggaagaccgcagcgaatggatc
ggcttcctcggcctgctcaagaaattccgtcccaaggcgccgatcaacggcatcatcgtc
accgccagcatcgccgagctgaccggcagccgtcccgagttcgccatcaacctggccaag
aacctgcgccagcgcgtgcaggagctgaccgagaagctggaggtgttcgcgccggtctac
gtgatgttcaccaaggccgacctgatcaccggcttcaccgagttcttcagcagcagcgac
cgccaggaatacgaccgcgtgtggggcgccaccctgccctacgagcccgacgagaagcgc
gacgtggtggcgctgttcgacgagcgcttcgaggaactctacgacggcctcaaggaaatc
agcgtcgcgcaactgtcgatcagccgcggcaacatcctctcgccgggccagctgagcttc
ccgctcgaattcgcctcgatcaagccgaccctgcgcgccttcctggccaccctgttcgag
aacaacccgttccagtacaagccgatcttccgcggcttctacttcaccagcgcgctgcag
gaaggcgaaaccaattccgccgccgcgcagcgcatcgcctcgcgcttcgcgctggacggc
agcgccctgcccaagccgcacagcgccttctcgaagaacggcttcttcctgcgcgacctg
ttctcgaaggtgatcttcgaggaccgcaagacggtgcgccagttcgccagccccgccaag
acgcggatgcgctacgccaccttcttcgccttcgtggcggtgctggcgctggcgctgggc
ggctggacctggtcgacgatcggcaaccagcagctggtggccaacgtgcaggccgacctc
gacaacatcgccaagctcgagcagaaccgcaacgacctccaatcgcgcctgcaggcgatg
gacatcctcgaggaccgcatcgagcagctcgagcagttccgccgcgacaagccgctctcg
gtctcgctgggcctctaccagggcgaccgcctggaagagcgcctgctcaccgagtactac
aacggcgtgcgccagatcatgctggcgccggtggccgacaatctcgccgccttcctgaag
gacgtcgacgcgcatccggaccagctcgcgccgatgacgcgcacgcccgaatcgggcgcg
gtgccggtctccgacaaatcggcgctgcagccgcaggcgcagggcgggctctacaacgac
gcctcgccgaccaatgtcgaggacgcctacaacgcgctgaagacctacctgatgctgtcg
gacaagcgccacgtcgagcaggcgcacctgaccgaccagatcgcgcgcttctggcgcggc
tggctggaaaccaatcgcgggaacatgccgcgcgacgagatgatccgcagcgccgagcgc
atgatcaccttctacctgtcgcgcgtgcaggacaacgactggccgatgatcgacgccaac
ctggccctggtcgaccagacccgcgagaacctgcgccacgtggtgcgcggcatgccggcc
cgccagcgcgtctacgaggagatcaaggcgcgcgcctcgacgcgttatgccccgatgacg
atcgcgcgcatcgtcggcgaggacaacaccggcctggtggccggcagctacgcgattccc
ggcaccttcacgcgcgacgcctggttcgactacgtgcagccggcgatccgcgacgcggcc
accaaggaactgcaggccaaggactgggtgctcaacaccgcctcgcaggacgacctgacg
ctggaaggcagccccgagcagatccagaaggtgctggtcggcatgtacaagaccgaatac
gcccagcactggcagaagttcatgcagggcatcgcggtgcagaacttcggcagcttcggc
caggccgtggacgccatgaacaagctcggcgacccgcaggactcgccgatccgcaaggtg
ctcgagaccgcctacgaccagacctcctgggataacccgtcgctggccaacgtgtcgatc
aagaaggcgcagaccggcgtggtgaactgggtcaagcagtggttctcgcgcaagccgggc
gggcagctggcggccaacatcgacatcaacggcaacccggtcgaggtgccgatgggcccg
atcggccaggagttcatcggcctgggccggatcgtgcagacccacgacggcggccagtcg
atgctcaagggctacatggacacgctctccaaggtgcgcacccgcttcaacgtgatcaag
aaccagggcgaccccggccccggcgcgcgccagctgatgcagcagacgctcgacggcaac
ggctcggaactggccgattcgctgaagtacgtcgacgagcagatgctgaccggcctgacc
gactcgcaacgcaagtcgctgcgcccgctgctggtgcgcccgctgcagcaggccttctcg
gtggtgatccagccggcctcggtggaagtcaacaaggtgtggaacgcgcaggtctaccag
ccgttccaggcctcgctggcgaacaagtacccgttctccgccggcgccaaggtggaggcc
gcctcgagcgagatcgcccaggtgttcggccccgacggctcgatctcgaagttcgtcggc
accacgctcgggccgctcgcggtgcgccgcggcgacacgctgacggcacgcacctggggc
gacatgggtctggcgctgacgccggaattcaccagcggcttcgcgacctgggtcgcgccg
ctggcggggggcgcggccaccagcgcggcctcctccgagccgcagacggtgttccagatc
ctgccgcagccgagcagcgggaccaccgagtacaccatcgcgatcgacggccagcagctg
cgctaccgcaacacgccgccgcagtggaccaacttcgtctggccgaacccgagcggttcg
ccgggtgcgacgctgacggccaccaccttcgacggccgcacgctgaccctggtcaacgag
ccgggccgctacgggctggagaagctgatcaactcggcgcagcgctcgcgccgcccggac
ggcaccttcgacctggcctggacgcagggcaacgtcaacgtggcggtgacgatgcgcatc
atcagcacctcgcagccctcgggcggcggcagcggtggcggcgacgcgccgcagcagcag
agcctgcgcggcctgcatctgccctcgtcggtggcgaacaccagcgcgagcggcgccgtc
aacgcgacggcccaggcacctgccggcacgtccggcgtcgcaacggccgccaacggcgcg
gccgccaacgcatcgaacgcacagggggcgcaatga

DBGET integrated database retrieval system