KEGG   Burkholderia gladioli BSR3: bgla_1g05010Help
Entry
bgla_1g05010      CDS       T01464                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00473  D-Alanine metabolism
bgd00550  Peptidoglycan biosynthesis
bgd01100  Metabolic pathways
bgd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    bgla_1g05010
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    bgla_1g05010
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    bgla_1g05010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bgd01011]
    bgla_1g05010
Enzymes [BR:bgd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     bgla_1g05010
Peptidoglycan biosynthesis and degradation proteins [BR:bgd01011]
 Precursor biosynthesis
  Amino acid ligase
   bgla_1g05010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST TTL ATP-grasp_3 BMC ATP-grasp_4 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: AEA59194
UniProt: F2L7I9
LinkDB All DBs
Position
1:562224..563165
Genome map
AA seq 313 aa AA seqDB search
MSGIDPKRFGKVAVLLGGVSAEREVSLKSGTLVVQGLREAGIDAHPFDPSERPLAALKDE
GYVRAFNALHGGYGENGQIQGALDFYGIRYTGTGVLGSALGLDKFRTKLVWQQTGIPTPP
FEVVLCGDDYAARAPEIVAKLGLPLFVKPASEGSSVAVIKVKDAAALPAALDEAARHDKI
VLVEKSIEGGGEYTACIAGDLDLPVIRIVPAGEFYDYHAKYIADDTQYLIPCGIEAGREA
EVKRLARRAFDVLGCTDWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGISYS
ELVVKVLAMTLED
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtactgttgggcggcgtgtcc
gccgagcgcgaggtatcgctgaaatcgggcacgctggtcgtgcaggggttgcgcgaggcc
ggcatcgacgcgcatccgttcgatccgtccgagcggccgctggccgcgctcaaggacgaa
ggctacgtgcgcgccttcaacgcgctgcacggcggctacggggagaacggccagatccag
ggcgcgctcgacttctatggcatccgctacaccggcaccggcgtgctcggctcggcgctc
ggcctcgacaagttccgcaccaagctggtctggcagcagaccggcatccccacgccgccg
ttcgaggtggtgctgtgcggcgacgactacgccgcgcgcgcgccggaaatcgtcgcgaag
ctgggtctgccgctgttcgtgaagccggccagcgagggctcgagcgtggcggtgatcaag
gtcaaggacgcggcggcgctgcctgccgcgctcgacgaggccgcgcggcacgacaagatc
gtgctggtcgagaagagcatcgagggcggcggcgagtacaccgcctgcatcgccggcgac
ctggacctgccggtgatccgcatcgtgccggccggcgagttctacgactaccacgcgaag
tacatcgccgacgacacgcaatacctgattccttgcggcatcgaggccggccgcgaagcc
gaagtcaagcgcctggcgcgtcgcgccttcgacgtgctgggctgcaccgactggggccgc
gccgacttcatgctcgacgcggcgggcaacccgtatttcctggaagtcaacaccgcgccg
ggcatgaccgaccactcgctgccgcccaaggcggcgcgcgcggtcggcatcagctactcg
gagctggtggtgaaggtgttggccatgacgctcgaagactga

DBGET integrated database retrieval system