KEGG   Burkholderia gladioli BSR3: bgla_1g05830
Entry
bgla_1g05830      CDS       T01464                                 

Definition
(GenBank) Leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    bgla_1g05830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bgd01007]
    bgla_1g05830
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bgd03016]
    bgla_1g05830
   03029 Mitochondrial biogenesis [BR:bgd03029]
    bgla_1g05830
Enzymes [BR:bgd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     bgla_1g05830
Amino acid related enzymes [BR:bgd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   bgla_1g05830
Transfer RNA biogenesis [BR:bgd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    bgla_1g05830
 Prokaryotic type
    bgla_1g05830
Mitochondrial biogenesis [BR:bgd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    bgla_1g05830
SSDB
Motif
Pfam: tRNA-synt_1_2 tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1e
Other DBs
NCBI-ProteinID: AEA59276
UniProt: F2L957
LinkDB
Position
1:646275..648869
AA seq 864 aa
MQERYVPADVEAAVQRDWRDTDAYLTKEDSQKPKFFCVSMLPYPSGKLHMGHVRNYTIND
VMYRYLRMNGYNTLMPMGWDAFGMPAENAAMANGVPPAKWTYDNIAYMKGQMQSMGLAID
WSREIATCKPDYYKWNQWLFLKMLEKGIAYKKTGTVNWDPVDQTVLANEQVIDGRGWRSG
ALIEKREIPMYYLRITQYADELLDDLDGLGWPERVKIMQQNWIGKSFGVNFGFPYELDGE
QKLLRVFTTRADTIMGVTFCAVAAEHPLATRLAEGRPELLAFIEECKQGGVAEADMATME
KKGVATGFSVKHPLTGEPVPVWIGNYVLMSYGEGAVMGVPAHDERDFAFANKYGLPMRQV
IAVDGETWSREAWQEWYGDKSKGVNVNSGKYDGLGHEAAVDAVSADLNAGGFGDKQVTWR
LRDWGVSRQRYWGTPIPIIHCPSCGDVPVPEADLPVVLPEDLVPDGTGNPLAKSEAFLNC
SCPKCGAPAKRETDTMDTFVDSSWYFSRYTAPDATTMVDARTDHWMPMDQYIGGIEHAIL
HLLYSRFWTKVMRDLGLVKFGEPAKNLLTQGMVLNETFYREDANGKKTWFNPADVTVTHD
DKGRPLGAVLNGDGQPVVLGGIEKMSKSKNNGVDPQLLIDQHGADTARLFTMFAAPPEQQ
LEWSGAGVEGASRFLRRVWAFASANREALVTRDALDATALDETAKALRREIHAVLKQADF
DYQRLQYNTVVSAAMKMLNAIEGAKGAPGAVLRETYGILLRVLYPVVPHLTFALWRELAY
ADEFGPLLDAPWPKVDEAALEQAEIELVLQINGKVRGAVKVAKDASREVIEAAALADEAF
AKFGEGKPAKKVIVVPGRLVNVVV
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgcaagaacgatacgtacccgccgacgtcgaagccgccgtccagcgcgattggcgcgat
accgacgcctacctgacgaaggaagattcgcaaaagccgaagttcttttgcgtgtcgatg
ctgccttacccgtccggcaagctgcacatgggtcacgtacgcaactacacgatcaacgac
gtgatgtaccgctatctgcggatgaacggctacaacacgctgatgccgatgggctgggac
gcgttcggcatgccggccgagaacgccgcgatggccaacggcgtgccgcccgcgaagtgg
acctacgacaacatcgcctacatgaagggccagatgcagtcgatgggcctggcgatcgac
tggtcgcgcgagatcgccacctgcaagcccgactactacaagtggaaccagtggctgttc
ctgaagatgctcgagaagggcatcgcctacaagaagacgggcaccgtcaactgggatccg
gtcgaccagaccgtgctggccaacgagcaggtgatcgacgggcgcggctggcgctcgggc
gcgctgatcgagaagcgcgagatcccgatgtactacctgcgtatcacgcagtacgccgac
gaactgctcgacgacctcgacggcctgggctggcccgagcgcgtcaagatcatgcagcag
aactggatcggcaagagcttcggcgtgaacttcggcttcccgtatgaactcgacggcgag
cagaagctgctgcgcgtgttcaccacgcgcgccgacaccatcatgggcgtgaccttctgc
gcggtggcggccgagcatccgctcgccacgcgcctggccgagggccgtcccgagctgctc
gccttcatcgaggagtgcaagcagggcggcgtggccgaggccgacatggccaccatggag
aagaagggcgtggccaccggcttctcggtcaagcacccgctcaccggcgagccggtgccg
gtgtggatcggcaactacgtgctgatgagctatggcgaaggcgccgtgatgggcgtgccc
gcgcacgacgagcgcgatttcgcgttcgccaacaagtacggcctgccgatgcggcaggtg
atcgccgtcgatggcgagacctggtcgcgcgaggcctggcaggagtggtacggcgacaag
tcgaagggcgtcaacgtcaacagcggcaagtacgacggcctgggccacgaggcggcggtc
gacgccgtgtcggccgacctgaacgcgggcggcttcggcgacaagcaggtcacctggcgc
ctgcgcgactggggcgtgtcgcgccagcgctactggggcacgccgatcccgatcatccac
tgcccgtcctgcggcgacgtgccggtgcccgaggcggacctgccggtggtcctgcccgag
gacctggtgccggacggcaccggcaacccgctggcgaaatccgaagccttcctgaactgc
agctgtccgaagtgcggcgcgccggccaagcgcgagaccgacaccatggacaccttcgtc
gactcgtcctggtacttctcgcgctacacggcgcccgacgcgacgaccatggtcgacgcg
cgcaccgatcactggatgccgatggaccagtacatcggcggcatcgagcacgcgatcctg
cacctgttgtactcgcgcttctggaccaaggtgatgcgcgacctgggcctggtgaagttc
ggcgagccggccaaaaatctgctcacccagggcatggtgctcaacgaaaccttctaccgc
gaggacgcgaacggcaagaagacctggttcaacccggccgacgtgaccgtcacgcacgac
gacaagggccgcccgctcggcgcggtgctcaacggcgacggccagccggtagtgctgggc
ggcatcgagaagatgtcgaagtcgaagaacaacggcgtcgatccgcaactgctgatcgac
caacacggcgccgacacggcccggctgttcaccatgttcgcggcgccgcccgagcagcag
ctcgaatggtcgggtgccggcgtggaaggcgcgagccgcttcctgcgccgcgtctgggcc
ttcgcctcggccaatcgcgaggcgctggtgacgcgcgatgcgctcgacgccaccgcgctc
gacgagaccgccaaggcgctgcgccgcgagatccacgccgtgctgaagcaggccgatttc
gactaccagcgcctgcagtacaacaccgtggtgtcggccgcgatgaagatgctcaacgcg
atcgagggtgccaagggcgcgccgggcgcggtgctgcgcgagacctacgggatcctgctg
cgcgtgctgtacccggtggtgccgcacctgaccttcgcgctgtggcgggaactcgcctat
gccgacgaattcggcccgctgctcgacgcgccctggccgaaggtcgacgaggccgcgctg
gagcaggccgagatcgagttggtgctgcagatcaacggcaaggtgcgcggcgcggtcaag
gtcgcgaaggacgccagccgcgaggtgatcgaggcggccgcgctcgccgacgaggcattc
gcgaagttcggcgagggcaagccggcgaagaaggtgatcgtcgtgccgggccgtctcgtc
aacgtggtggtctga

DBGET integrated database retrieval system