KEGG   Burkholderia gladioli BSR3: bgla_1g10370
Entry
bgla_1g10370      CDS       T01464                                 

Definition
(GenBank) 50S ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    bgla_1g10370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bgd03011]
    bgla_1g10370
   03029 Mitochondrial biogenesis [BR:bgd03029]
    bgla_1g10370
Ribosome [BR:bgd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    bgla_1g10370
  Bacteria
    bgla_1g10370
Mitochondrial biogenesis [BR:bgd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    bgla_1g10370
SSDB
Motif
Pfam: Ribosomal_L32p
Other DBs
NCBI-ProteinID: AEA59720
UniProt: F2L825
LinkDB
Position
1:1154347..1154526
AA seq 59 aa
MAVQQNKKSPSKRGMHRSHDFLTTTPLAVEPSTGEVHMRHHISPNGYYRGKKVVKTKND
NT seq 180 nt   +upstreamnt  +downstreamnt
atggcagttcagcaaaacaagaagtcgccgtccaagcgcggcatgcaccgttcgcacgat
ttcctgacgaccaccccgctggccgtcgagccgagcacgggtgaagtgcatatgcgtcac
cacatcagcccgaacggctactatcgcggcaagaaagtcgtcaagacgaagaacgactaa

DBGET integrated database retrieval system