KEGG   Burkholderia gladioli BSR3: bgla_1g10530
Entry
bgla_1g10530      CDS       T01464                                 

Definition
(GenBank) GTP-binding protein Era
  KO
K03595  GTPase
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bgd03009]
    bgla_1g10530
   03029 Mitochondrial biogenesis [BR:bgd03029]
    bgla_1g10530
Ribosome biogenesis [BR:bgd03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   bgla_1g10530
 Prokaryotic type
  GTPases
   bgla_1g10530
Mitochondrial biogenesis [BR:bgd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    bgla_1g10530
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N AIG1 Dynamin_N RsgA_GTPase GTP_EFTU AAA_22 cobW ABC_tran Roc AAA_29 Ploopntkinase3 PduV-EutP KH_1 Septin MMR_HSR1_Xtn
Other DBs
NCBI-ProteinID: AEA59736
UniProt: F2L841
LinkDB
Position
1:1169458..1170360
AA seq 300 aa
MNAPATPAGFRCGMIAIVGRPNVGKSTLMNALVGQKISITSRKAQTTRHRITGIHTLPDA
QYIFVDTPGFQTRHSTALNRSLNRTVTSTLTSVDAILFVIEAGRFGPDDQKVLDLIPKSV
PTLLILNKLDRITDKSSLFPFLKQMGELREFAEVVPLSAKHVDDISRLMETVKPYLPEGE
PIYGEDDLTDRSSRFLAAEILREKVFRWTGDELPYTSTVIIDKFEEEGRLTRVFATILVE
RDSHKAMVIGKKGAKLKQISTEARLDMEKLFDGPVYLETFIKVKSGWADNEAGLRAYGYE
NT seq 903 nt   +upstreamnt  +downstreamnt
atgaacgcacccgccactcccgccggtttccgttgcggcatgatcgccatcgtcggccgg
cccaacgtcggcaagtcgacgctgatgaacgcgctggtcggccagaagatcagcatcacc
tcgcgcaaggcgcagaccacgcgccaccgcatcaccggcatccacacgctgcccgacgcg
cagtacatcttcgtcgacacgcccggtttccagacccgccacagcaccgcgctgaaccgc
tcgctgaatcgcaccgtcacctcgacgctgacttcggtcgacgcgatcctgttcgtgatc
gaggcgggccgcttcggtcccgacgaccagaaggtgctcgacctgatcccgaagagcgtg
ccgaccctgctgatcctcaacaagctcgaccggatcaccgacaagagctcgctgttcccg
ttcctgaagcagatgggcgagctgcgcgagttcgccgaggtggtgcccctgtcggccaag
catgtcgacgacatcagccgcctgatggagacggtcaagccctacctgccggaaggcgag
ccgatctacggcgaggacgacctgaccgatcgcagctcgcgcttcctcgccgccgagatc
ctgcgcgagaaggtgtttcgctggaccggcgacgagctgccgtacaccagcaccgtgatc
atcgacaagttcgaggaggaagggcgcctgacgcgggtgttcgccaccatcctggtcgag
cgcgattcgcacaaggcgatggtgatcggcaagaagggcgccaagctcaagcagatcagc
accgaggcgcggctcgacatggagaagctgttcgatggaccggtctatctcgaaaccttc
atcaaggtgaagagcggctgggccgacaacgaagcagggctccgtgcctatgggtacgaa
tga

DBGET integrated database retrieval system