KEGG   Burkholderia gladioli BSR3: bgla_1g18060Help
Entry
bgla_1g18060      CDS       T01464                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00020  Citrate cycle (TCA cycle)
bgd00310  Lysine degradation
bgd00380  Tryptophan metabolism
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
bgd01130  Biosynthesis of antibiotics
bgd01200  Carbon metabolism
Module
bgd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bgla_1g18060
  09105 Amino acid metabolism
   00310 Lysine degradation
    bgla_1g18060
   00380 Tryptophan metabolism
    bgla_1g18060
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     bgla_1g18060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N DUF2680
Motif
Other DBs
NCBI-ProteinID: AEA60451
UniProt: F2LB96
LinkDB All DBs
Position
1:2040153..2043023
Genome map
AA seq 956 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYEAYLDNPASVPDNWREYFDALQNVPATDGSNAND
VAHFPIVESFAQRAKANAFIPRDSGNAGNLATARKQVHVQSLISAYRFLGSQWANLDPLK
RRERPAIPELEPAFYDFSEADLDQTFSASNLYFGFEQASLRDIVKSLRDTYCGTIGAEYM
YIGDPEQKRWWQERLESTRATPNFTADKKKHVLNRLTAAEGLERYLHTKYVGQKRFSLEG
GESFIAAMDEVVQHSGSKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLP
AGDVKYHKGFSSDIATEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDADGLQVLP
VQIHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDV
VKMIEAPVLHVNGDDPEAVVLAVQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQP
LMYKKIAQHPGTRALYAEKLVQQGVITAEQGDEFVKAYRKAMDDGHHTVDPVLSNYKSKY
AVDWVPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRKMAQGDQ
PLDWGMGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNI
SEGQANFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGE
VKWGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQMCADHNMQVVQPTTPAQIFHLLRRQM
IRLFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGETDQSIDAKKVKRVLACSGRV
YYDLVAHRREAKANDVAIIRIEQLYPFAHKQFEAELKKYDNATEVVWVQDEPQNQGPWFY
IEHHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagttccagctgaactcctatctgttcggcggcaatgcttcg
tatgtagaagaactgtacgaagcctacctggacaacccggcgtcggtgccggacaactgg
cgcgagtatttcgacgcgctgcagaacgtgccggctacggatggttcgaacgcgaacgac
gtcgcccactttccgatcgtcgaatcctttgcccagcgcgccaaggccaatgccttcatc
ccgcgcgacagcggcaatgccggcaatctggccaccgcgcgcaagcaggtccacgtccag
tccctgatcagcgcctatcgcttcctcggctcgcaatgggccaatctcgatcccctgaag
cgtcgcgagcgccccgcgatccccgagctcgaacccgcgttctacgacttctccgaagcc
gacctcgaccagacgttcagcgccagcaacctgtatttcggtttcgagcaggcttcgctg
cgtgacatcgtcaagtcgctgcgcgacacgtattgcggcacgatcggcgccgagtacatg
tacatcggcgatccggagcagaagcgctggtggcaggagcgtctcgagtcgacgcgcgcc
acgccgaacttcacggccgacaagaagaagcacgtgctgaaccgcctgacggccgccgaa
ggcctcgagcgctacctgcacaccaagtacgtcggccagaagcgcttctcgcttgaaggc
ggcgaaagcttcatcgcggcgatggacgaagtggtccagcattcgggttcgaagggcgtc
caggaaatcgtcatcggcatggcccaccgtggccgcctgaacgtgctggtcaatacgctc
ggcaagatgccggccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccg
gccggcgacgtgaagtaccacaagggcttctcgtcggacatcgccaccgaaggcggcccg
gtccacctgtcgctcgcgttcaacccctcgcacctggaaatcgtcaacccggtggtcgaa
ggttcggccaaggcccggatggaccgtcgcggcgacgccgacggcctgcaggtgctgccg
gtgcagatccacggcgacgcggccttcgcgggccagggcgtggtgatggaaacgctgaac
ctggcgcagacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccag
atcggcttcaccacctcggacccgcgcgacgcgcgttcgacgctgtactgcaccgacgtg
gtcaagatgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagcggtggtg
ctcgcggtgcagatcgcgatcgactatcgcatgcagttccacaaggatgtcgtgatcgac
atcgtctgcttccgcaagctcggccacaacgagcaggacacgccggcggtcacgcagccg
ctgatgtacaagaagatcgcgcagcacccgggtacccgcgcgctgtacgccgagaagctg
gtgcagcagggcgtgatcaccgccgagcagggcgacgagttcgtcaaggcctatcgcaag
gcgatggacgacggccaccacacggtcgatccggtgctctcgaactacaagagcaagtac
gcggtcgactgggtgccgttcctgaaccgcaagtggaccgacgcggccgacacggccgtg
ccgctggccgagctgaagcgcctcggcgagcgcatcaccacggtgccggagaacttcaag
gtccacccgctggtcgagcgcgtgatcaacgaccgccgcaagatggcccagggcgatcaa
ccgctcgactggggcatgggcgagcacctcgcgttcgcctcgctggtcgcatcgggctac
gccgtgcgactgaccggccaggattcgggccggggcaccttcacgcaccgtcacgcggtg
ctgcacgaccagaaccgcgagcgctggaacgacggcacctacgtgccgctgcagaatatc
tcggaaggccaggcgaacttcacggtgatcgactcggtgctgtcggaagaagcggtgctc
ggcttcgagtacggctactcgaccgccgaaccgaacacgctggtgctgtgggaagcgcag
ttcggcgacttcgtgaatggcgcgcaggtggtgatcgaccagttcatctcctcgggtgaa
gtgaagtggggccgcgtctcgggcctgacgatgctgctgccgcacggctacgaaggccag
ggtcctgagcactcgtccacgcgtatcgagcgtttcctgcagatgtgcgcggatcacaac
atgcaggtggtccagccgaccacccccgcgcagatcttccacctgctgcgtcgccagatg
atccgcctgttccgcaagccgctgatcgtcgccacgccgaagtcgcttctgcgccacaag
gaagcggtctcggacctgtcggaactggccaagggttcgttccaaccggtactcggcgaa
accgaccagtcgatcgacgcgaagaaggtcaagcgcgtgctggcctgctcgggccgcgtg
tattacgacctggtcgcgcatcgccgcgaagcgaaggcgaacgacgtggcgatcatccgg
atcgagcaactctatccgttcgcgcacaagcagttcgaagcggagctgaagaagtacgac
aacgcgaccgaagtggtctgggtgcaggacgagccgcagaatcagggcccgtggttctac
atcgaacaccacctgaaggaaggcatgaaggaagggcagaagctcgcgtacagcggccgc
ccggcttccgcctcgccggcggtcggttactacgcgaagcactacgagcagcagaaggcc
ctgatcgaaggggcattcggccgcctgaagagcgcgtcgatcgcaaaataa

DBGET integrated database retrieval system