KEGG   Burkholderia gladioli BSR3: bgla_1g23470
Entry
bgla_1g23470      CDS       T01464                                 

Definition
(GenBank) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    bgla_1g23470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bgd03011]
    bgla_1g23470
   03029 Mitochondrial biogenesis [BR:bgd03029]
    bgla_1g23470
Ribosome [BR:bgd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    bgla_1g23470
  Bacteria
    bgla_1g23470
Mitochondrial biogenesis [BR:bgd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    bgla_1g23470
SSDB
Motif
Pfam: Ribosomal_S6
Other DBs
NCBI-ProteinID: AEA60974
UniProt: F2LDP9
LinkDB
Position
1:complement(2695477..2695851)
AA seq 124 aa
MRHYEIVFIVHPDQSEQVPAMIERYKSTITTRGGQIHRVEDWGRRQLAYMIEKLAKAHYV
CLNIECDQATLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQREEAKKAAAAQPT
EAQA
NT seq 375 nt   +upstreamnt  +downstreamnt
atgcgtcattacgaaatcgtctttatcgtgcaccccgatcagagcgagcaagtgcccgcc
atgatcgagcgttacaagtccacgatcaccacgcgcggcggccagatccaccgcgtcgag
gactggggccgtcgtcaactggcctacatgatcgagaaactcgccaaggctcactacgtc
tgcctgaacatcgagtgcgaccaggctacgctcgacgaactcgaacacgcgttcaagttc
aacgacgcggtgctgcgtcacctcatcgtcaagatgaagaaggccgaaaccggcccgtcg
ccgatgatgaaggaagttcagcgcgaagaagccaagaaggcggctgctgcccagccgacc
gaagcgcaggcttaa

DBGET integrated database retrieval system