KEGG   Burkholderia gladioli BSR3: bgla_1g25570Help
Entry
bgla_1g25570      CDS       T01464                                 

Definition
(GenBank) 3R-hydroxymyristoyl ACP dehydrase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00061  Fatty acid biosynthesis
bgd00780  Biotin metabolism
bgd01100  Metabolic pathways
bgd01212  Fatty acid metabolism
Module
bgd_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    bgla_1g25570
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    bgla_1g25570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bgd01004]
    bgla_1g25570
Enzymes [BR:bgd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     bgla_1g25570
Lipid biosynthesis proteins [BR:bgd01004]
 Fatty acid synthase
  Component type
   bgla_1g25570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AEA61177
UniProt: F2LFL1
LinkDB All DBs
Position
1:complement(2930464..2930931)
Genome map
AA seq 155 aa AA seqDB search
MSIEQINFDIHKILTLLPHRYPILLVDRVLELTPHESIKALKNVTINEPFFQGHFPQRPV
MPGVLIIEALAQAAALLTFSEEQPKDPGKSLYYFVGIDGARFKRVVEPGDQLILNVKFER
YIRGIWKFKATAEVDGKVAAEAELMCTVKSADAAP
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaacaaatcaatttcgacatccacaagatcctcacgctgctgccgcatcgt
tatccgattctgctcgtcgaccgcgtgctcgaactcaccccgcacgaaagcatcaaagcc
ctgaagaacgtgaccatcaacgagccgttcttccaggggcatttcccgcagcgcccggtg
atgccgggcgtgctgatcatcgaggcgctggcgcaggccgcggcgctcttgaccttcagc
gaggaacagccgaaggatccgggcaagtcgctgtactacttcgtcggcatcgacggcgcg
cgcttcaagcgcgtggtcgagccgggcgaccagctgatcctgaacgtgaagttcgagcgc
tacatccgcggcatctggaagttcaaggcgaccgccgaagtcgacggcaaggtggccgcc
gaggccgaactgatgtgcacggtgaagtcggccgacgccgcgccctga

DBGET integrated database retrieval system