KEGG   Burkholderia gladioli BSR3: bgla_1g29040Help
Entry
bgla_1g29040      CDS       T01464                                 

Definition
(GenBank) Glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    bgla_1g29040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgd02000]
    bgla_1g29040
Enzymes [BR:bgd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     bgla_1g29040
Transporters [BR:bgd02000]
 Other Transporters
  Pores ion channels [TC:1]
   bgla_1g29040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AEA61516
UniProt: F2LDW2
LinkDB All DBs
Position
1:complement(3310412..3311065)
Genome map
AA seq 217 aa AA seqDB search
MLQLCGLPLSNYYNKVKLVLLDHEIDFEEQIHTLPLSGDEALDASPFGKVPFLRTEHGAL
SESQAIVEYLGACYPEKGLFPADPFEAAKVREITVFVELYLEWVARSLYGQAFFGGTASE
ETQQRVEKRLVGALAAFRKMTRFAPYVLGETYGMADAAAYIHLPIVGLATKAVYGRDLVV
EAGIDWKAYSKLVGERPAAQRVSADRKAYLEANGARR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagctctgtggtttgcccttatcgaactactacaacaaggtgaagctggtgctg
ctcgatcacgagatcgatttcgaggagcagattcatacgctgccactgagcggtgacgag
gcgctcgacgcctcgccgttcggcaaggtgccgttcctgcgcaccgagcacggcgcgctg
tcggaatcgcaggcgatcgtcgagtaccttggcgcgtgttatccggagaagggcctgttc
ccggccgatccgttcgaggcggccaaggtgcgggaaatcaccgtcttcgtcgaactgtat
ctcgaatgggtcgcgcgcagcctgtacgggcaggcatttttcggcggcacggccagcgag
gagacgcagcagcgcgtcgagaagcgcctggtcggcgcgctggccgcgtttcgcaagatg
acgcgcttcgcgccctacgtgctcggcgagacctacgggatggccgacgcggccgcctat
atccacctgccgatcgtggggctcgcgaccaaggccgtgtatggccgcgatctggtggtc
gaggcgggaatcgactggaaggcgtattcgaagctggtgggcgagcgtcccgccgcgcag
cgcgtgagcgccgatcgcaaggcttatctcgaggcgaacggcgccaggcgctag

DBGET integrated database retrieval system