KEGG   Burkholderia gladioli BSR3: bgla_1g33840Help
Entry
bgla_1g33840      CDS       T01464                                 

Definition
(GenBank) Multidrug resistance efflux pump
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgd02000]
    bgla_1g33840
Transporters [BR:bgd02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   bgla_1g33840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 HlyD Biotin_lipoyl_2 Biotin_lipoyl Tektin RskA HlyD_2 PTS_EIIA_1 Atg14 Phage_Mu_Gam Med15 TPR_MLP1_2
Motif
Other DBs
NCBI-ProteinID: AEA61987
UniProt: F2LAI4
LinkDB All DBs
Position
1:3842723..3843838
Genome map
AA seq 371 aa AA seqDB search
MSSTTQEPPKGNRQETSEPAPKRPSRRRNILILIAIVAAIAGLVWLVHWWTVGRFIESTN
DAYLQADSMTAAPKVSGYVTDVYVRDNQSVKAGDPLVKLDVRQYQVSLQNSLASVDARRA
DIARTQADIAQQHANLEQAQAQAQVSSINLKHASEEYARYAPLAATGAETHERIADLKNT
RDQAQATLAANNASIAAARAQINSSTAQLQQAQAQLEAAQASAAQSQLDLDNTVVRSTLD
GRVGDRTVRVGQYVQPGTRLLTVVPVQDIYLVANFKETQVGRMRVGQPVTLHVDALPDRT
LHGTVDSFSPGTGSQFALLPPDNATGNFTKIVQRVPVRIHVDTDDETRRVLLPGLSVDVD
VDTRDDGQHHG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgaccactcaagaaccgccgaaaggcaatcgtcaggaaacctcggaacctgcg
ccgaagcggccttcgcgccggcgcaacatcctgatcctcatcgcgatcgtcgcggcgatc
gccggcctggtctggctggtccattggtggaccgtcggccgcttcatcgaatcgaccaac
gatgcctacctgcaggccgacagcatgacggccgcgccgaaggtgtcgggctacgtgacc
gacgtctacgtgcgcgacaaccagagcgtcaaggccggcgacccgctggtgaagctcgac
gtccgccagtatcaggtttccctgcagaattcgctggcaagcgtcgatgcgcggcgcgcc
gacatcgcgcgcacccaggccgacatcgcccagcagcacgccaatctcgaacaggcgcag
gcccaggcccaggtgtcgagcatcaacctgaagcacgccagcgaggaatatgcgcgctac
gcgccgctggcggccaccggcgccgaaacgcacgagcgcatcgccgacctgaagaacacg
cgcgaccaggcgcaggccacgctggcggcgaacaacgcctcgatcgcggcggcccgcgcc
cagatcaactccagcaccgcccagctgcagcaggcccaggcccagctcgaggcggcccag
gccagcgccgcgcaatcgcagctcgacctcgacaacacggtggtgcgcagcacgctggac
ggccgcgtgggcgatcgcacggtgcgcgtcggccagtacgtgcagcccggcacgcgcctc
ttgacggtggtgccggtgcaggacatctacctggtcgccaacttcaaggaaacccaggtg
ggccgcatgcgggtgggccagccggtcacgctgcacgtggacgcgctgcccgatcgcacg
ctgcacggcacggtcgacagcttctcgccgggcaccggctcgcagttcgcgctgctgcca
cccgacaacgccaccggcaacttcaccaagatcgtgcagcgcgtgccggtgcgcatccac
gtcgataccgacgacgagacccgccgcgtgctgctgccgggcctgtcggtggacgtcgac
gtcgatacccgcgacgacgggcagcatcatggctga

DBGET integrated database retrieval system