KEGG   Burkholderia gladioli BSR3: bgla_1g38130Help
Entry
bgla_1g38130      CDS       T01464                                 

Definition
(GenBank) Glutamyl-tRNA
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00970  Aminoacyl-tRNA biosynthesis
bgd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    bgla_1g38130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bgd03029]
    bgla_1g38130
Enzymes [BR:bgd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     bgla_1g38130
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     bgla_1g38130
Mitochondrial biogenesis [BR:bgd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    bgla_1g38130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF3941
Motif
Other DBs
NCBI-ProteinID: AEA62415
UniProt: F2LGI7
LinkDB All DBs
Position
1:complement(4333561..4335036)
Genome map
AA seq 491 aa AA seqDB search
MAQQWEVVIGLETHAQLSTASKIFSGASTQFGAEPNTQACAVDLALPGVLPVLNRGAVER
AIRLGLALGSTVAQRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQLTIQVPANEKAGKE
AYSKTINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAK
ALHALVMWLGICDGNMQEGSFRCDANVSVRPLGQEKFGTRAEIKNLNSFRFLEDAINYEV
RRQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAQDYRYFPDPDLMPVVIDPKWVERV
RGEMPELPAAMQQRFVEQYGVTPYDAVVLTASKAMAAYFEAVVGKAGVANAKVAANWLMG
DVSSLLNREGIEIDASPVSAAQLALVLQRIADGTISNKIAKEIFQAIWDEKAGDEAAADR
IIEAKGLKQISDSGALEAIIDEVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANPA
QVNELLKKKLG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcagtgggaagtcgttatcggtctggagacgcacgcgcaattgtcgacggcg
tcgaagatcttctcgggcgcctcgacgcagttcggcgccgaacccaacacccaggcctgc
gcggtcgatctcgccctgcccggcgtgctgccggtgctcaaccgcggcgcggtggagcgg
gcgatccggctgggcctcgcgctcggctcgacggtggcgcagcgcagcatcttcgcgcgc
aagaattacttctacccggatcttcccaagggctaccagatcagccagtacgagatcccg
gtggtgcagggcggccagctcacgatccaggtgccggccaacgagaaggcgggcaaggaa
gcctactcgaagaccatcaacctgacgcgcgcccacctggaagaggatgccggcaagtcg
ctgcacgaggacttcgcgggcatgacgggcatcgacctgaaccgtgccggcacgccgctg
ctcgagatcgtcaccgagcccgagatgcgcagcgccgccgaggcggtggcctatgccaag
gcgctgcacgcgctggtgatgtggctcggcatctgcgacggcaacatgcaggaaggctcg
ttccgctgcgacgcgaacgtctcggtgcgcccgctggggcaggagaagttcggcacgcgc
gccgagatcaagaacctgaactcgttccgcttcctggaggacgccatcaactacgaggtg
cgtcgccagatcgaattgatcgaggacggcggcacggtggtgcaggaaacccgcctctac
gatccggacaagcgcgagacgcgctcgatgcgcagcaaggaagacgcgcaggattaccgc
tatttcccggatccggacctgatgccggtggtgatcgacccgaagtgggtcgagcgcgtg
cgcggcgagatgccggagctgccggccgcgatgcagcagcgtttcgtcgagcagtatggc
gtgacgccctatgacgcggtggtgctgaccgccagcaaggcgatggcggcctacttcgag
gcggtggtgggcaaggccggcgtggccaatgccaaggtggccgcgaactggctgatgggc
gacgtgtcgtcgctgctgaaccgcgagggcatcgagatcgacgccagccccgtgtcggcc
gcccagctcgcgctggtgctgcagcgcatcgccgacggcaccatctcgaacaagatcgcc
aaggaaatcttccaggcgatctgggacgagaaggccggcgacgaagccgccgccgatcgc
atcatcgaggccaaggggctcaagcagatctccgacagcggcgcgctggaggcgatcatc
gacgaggtgctggcggccaacgccaagtcggtcgaggagttccgcgccggcaaggagaag
gccttcaacgcgctggtcggccaggcgatgaaggcgaccaagggcaaggcgaacccggcc
caggtcaacgagctgctgaagaagaagctgggctga

DBGET integrated database retrieval system