KEGG   Burkholderia gladioli BSR3: bgla_2g03850Help
Entry
bgla_2g03850      CDS       T01464                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bgd01001]
    bgla_2g03850
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     bgla_2g03850
Protein kinases [BR:bgd01001]
 Serine/threonine kinases: Other
  Bacterial family
   bgla_2g03850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like
Motif
Other DBs
NCBI-ProteinID: AEA62861
UniProt: F2LJJ4
LinkDB All DBs
Position
2:complement(484392..485831)
Genome map
AA seq 479 aa AA seqDB search
MTRPPEPLPASIGRYRIEHVLGRGAMGVVYLATDPHIQRPVALKTIRGELLHAAEAGGEP
GIAAEAALPARFINEARAAGRLVHPNIVGVFDYGEADGTAYIAFEYVRGETLAARLAAHA
RQGTRMPARNVLVWFAQLLDALAYAHELGVIHRDIKPANLLIAPRGECKITDFGIAQLDT
GRLTQVGMLIGTPSYMSPEQVSGAPIDARSDLFSAGVVLYEMLTGRCPFAGSSAAVMRQV
LDETPAPPSSLAPALPPELDAMVLQALAKDPGQRHASAQHWRGEVLALLETLAARLDPDQ
TIVLAPLAQAGLAPPPPAAEARTLPVDWSPEFLAQLEQRLVTHVGPVASRLVRRAAAQAT
DPRMLAAELARHLPDEAARHDFDTLLQRHAASGTAVTRVMAMPGATQAGSGAGQAPVVDT
ALVETAVQRLATHIGPIARIVARRAAVDADLATFQARLLEALPDSVDKAAFLRGLDEGS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcccgccggaaccgctgccggccagcatcggccgctaccgcatcgaacacgtg
ctgggccgcggcgcgatgggcgtggtctatctcgccaccgatccgcatatccagcggccg
gtggcgctcaagaccatccgcggcgagctgctgcacgcggccgaggcgggcggcgagccc
ggcatcgccgccgaggccgcgctgccggcgcgcttcatcaacgaggcgcgcgccgccggg
cggctggtgcatccgaatatcgtcggcgtgttcgactacggcgaggccgacggcacggcc
tatatcgccttcgaatatgtgcgcggcgagaccctggccgcgcgactcgccgcgcacgcg
cgccagggcacgcgcatgccggcgcgcaacgtgctggtgtggttcgcgcaactgctggac
gcgctcgcctacgcgcacgagctcggcgtgatccatcgcgacatcaagccggccaacctg
ctgatcgcgccgcgcggcgagtgcaagatcaccgacttcggcatcgcccagctcgatacc
gggcgcctcacccaggtcggcatgctgatcggcacgcccagctacatgtcgccggagcag
gtctcgggcgcgccgatcgacgcgcgcagcgacctgttctcggccggcgtggtgctctac
gagatgctgaccggccgctgcccgttcgcgggctcgtcggcggcggtgatgcggcaggtg
ctcgacgagacgcccgcgccgccctccagcctcgcgccggcgctgccgcccgagctcgac
gcgatggtgctgcaggcgctggccaaggatccggggcagcgccacgcctcggcgcagcac
tggcgcggcgaagtgctggccctgctggagacgctcgcggccaggctcgacccggaccag
accatcgtgctcgcgccgctcgcgcaggcggggctggccccgccgccgccggccgccgag
gcgcgcacgctgccggtcgactggtcgccggagttcctagcgcagttggagcagcggctg
gtcacccatgtcgggccggtggcctcgcggctggtgcggcgcgcggcggcgcaggccacc
gatccgcgcatgctggccgccgagttggcgcgccacctgcccgacgaggccgcgcgccac
gacttcgatacgctgctgcagcgtcacgcggcttcgggcacggccgtcacgcgcgtgatg
gcgatgccgggggcgacgcaggcgggcagcggggccggccaggcgccggtcgtggatacg
gcgctggtcgagacggcggtgcagcggctcgccacccatatcgggccgatcgcgcggatc
gtggcgcggcgcgcggcggtcgatgccgatctcgccaccttccaggcgcggctgctggag
gccctgccggattcggtggacaaggccgcgttcctgcgtgggctcgacgagggttcgtag

DBGET integrated database retrieval system