KEGG   Burkholderia gladioli BSR3: bgla_2g04910Help
Entry
bgla_2g04910      CDS       T01464                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00250  Alanine, aspartate and glutamate metabolism
bgd00410  beta-Alanine metabolism
bgd00640  Propanoate metabolism
bgd00650  Butanoate metabolism
bgd01100  Metabolic pathways
bgd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    bgla_2g04910
   00650 Butanoate metabolism
    bgla_2g04910
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    bgla_2g04910
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    bgla_2g04910
Enzymes [BR:bgd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     bgla_2g04910
Amino acid related enzymes [BR:bgd01007]
 Aminotransferase (transaminase)
  Class III
   bgla_2g04910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEA62967
UniProt: F2LKS1
LinkDB All DBs
Position
2:complement(624150..625433)
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVMNTGHRHPK
LVKAIAEQLECFTHTAYQIVPYASYVELAEKIIARAPGSQAKKAAFFTTGAEAVENAVKM
ARAFTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGISVA
DSLKAIDMLFKADIDPKRVAAIIFEPVQGEGGFYAAPADFVRGLRKICDEHGIVLIADEV
QTGFARTGKLFAMQHYDVLPDLTTMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDIIDEEKLEARATALGDKLKAKLSALQSEVPQIVDVRGPGAMVAVEFFK
AGTQEPDADFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIQDAVFDEALGILEEVLK
ETVGVAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaagcccgcaagaacgccgccacgccgcgtggcgttggcgtg
atgtgcgatttctacgccgcgcgcgccgagaacgccgaactgtgggacgtcgagggccgc
cgcttcatcgacttcgccgccggcatcgccgtgatgaacaccggccaccgtcatccgaag
ctggtcaaggcgatcgccgagcagctcgagtgcttcacgcataccgcctaccagatcgtc
ccctacgcgtcctacgtcgagctggccgagaagatcatcgcccgcgcgccgggcagccag
gccaagaaggcggccttcttcaccaccggcgccgaggccgtcgagaacgccgtcaagatg
gcgcgcgccttcaccggccggccgggcgtgatcgccttcgccggcggcttccatggccgc
accatgatgggcatggcgctgaccggcaaggtcgccccctacaagctgaacttcggcccg
ttcccgggcgacgtgttccacgccccctatccgaacgcgctgcacggcatcagcgtggcc
gattcgctgaaggcgatcgacatgcttttcaaggccgacatcgatccgaagcgtgtcgcc
gcgatcatcttcgaaccggtgcagggcgaaggcggcttctacgcggcgccggccgatttc
gtgcgcggcctgcgcaagatctgcgacgaacacggcatcgtgctgatcgccgacgaagtg
cagaccggcttcgcgcgcaccggcaagctgttcgcgatgcagcactacgacgtgctgccg
gacctgaccaccatggccaagagcctggccggcggcatgccgctgtcgggcgtggtcggc
cgcgccgacgtgatggacgcggccgcgcccggcggcctgggcggcacctacgcgggcaac
ccgctggcggtggccgcggcccacgcggtgctcgacatcatcgacgaggaaaagctggaa
gcgcgcgccaccgcgctcggcgacaagctgaaggcgaagctctcggcgctgcaatcggag
gtgccgcagatcgtcgacgtgcgcggcccgggcgcgatggtcgcggtcgagttcttcaag
gccggcacgcaggagcccgatgccgatttcaccaagcgcgtgcaggcgcgcgcgctcgag
cgcgggctgttgctgctggtgtgcggcgtgtattcgaacgtggtgcgcttcctgttcccg
ctgacgatccaggacgccgtgttcgacgaggcgctcggcatcctcgaggaagtgctgaag
gaaaccgtcggcgtcgccgcctga

DBGET integrated database retrieval system