KEGG   Burkholderia gladioli BSR3: bgla_2g09360Help
Entry
bgla_2g09360      CDS       T01464                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00500  Starch and sucrose metabolism
bgd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bgla_2g09360
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     bgla_2g09360
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     bgla_2g09360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: AEA63397
UniProt: F2LJU9
LinkDB All DBs
Position
2:complement(1175464..1178928)
Genome map
AA seq 1154 aa AA seqDB search
MIREDTLDSPQHAPFQRGADSARRGTRRNGARFSERGTLAGDPLWYKDAIIYQLHVKSFF
DSNGDGIGDFPGLISKLDYIASLGVDALWLLPFYPSPRRDDGYDIADYRNVHPDYGTLAD
VRRFIREAHARGIRVITELVINHTSDQHPWFQRARRAKRGSVHRDYYVWSDTDTKFAGTR
VIFVDSEPSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVLQIMRFWLDLGIDGLRL
DAVPYLVEREGTSNENLPETHAVLKRIRAAIDAEYPNRMLLAEANQWPEDVQEYFGREDE
CHMAFHFPLMPRIYMSIASEDRFPIIDIMRQTPELAPSNQWAIFLRNHDELTLEMVTDAE
RDMLWQAYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMG
DNIHLGDRDGVRTPMQWSADRNGGFSRADPEQLVLPPVMGALYGFDAVNVEAQSRDPHSL
LNWMRRILATRRATQVFGRGTLRFLRPENRKVLAYLRELPDATPVLCVANLSRASQAVEL
DLSEFAGSVPVEMTSDSPFPAIGELPYLLTFPPYGFLWFSLSPTGAEPAWHRPHAEPLPE
YTTLVMRRGDAQPAAPLVATLEAEVLPQWLTRRRWFASKDRSLDAARFDCVTPIPGEPFQ
YAEVVASSDGREERYVVPLAAAWGDETPHPLFMRLALARVRRGPTVGYLTDAFALPGFAH
GVLAKLAERASVPLTSGGTLVFSPEPTLTEVMQALGPTPGIRWLAAEQSNSSLVIGETLV
LKLVRRVAAGIHPEAEMSRHLTRAGYANAPALAGEVLRVGADGTPHTVAIVQAFVDNQGD
AWVRSLDFLKRAVGDLALSASATPDAQEADGEADEIDAYAEFAGAIGTRLGELHVTLAAP
TDDPAFAPERATPAHVARWTQDAIAMVDRAMSLLAPRLDDLDDGVRDAALALLASREDLV
AALDSLLPEHLDAICTRIHGDFHLGQVLDVHGDAMLIDFEGEPARALDARRAKSHPLRDV
AGLLRSLSYASAAAQFSIEKAPAPTADLKRTLFDRFGQAAADRFLANYRRAVELAPTPFA
GPADAERLLMLFLVEKAAYELAYEAANRPDWLSVPVLGLAALSAQLLGRDRGPDEDAPSS
ESHSPDELPPENPQ
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgaagacaccctcgattcgccgcaacacgcgccgttccagcgcggcgccgac
agcgcccggcgcggcacgcgccgcaacggggcgcgcttttccgaacgcggcaccctggcc
ggcgatccgctctggtacaaggacgcgatcatctaccagctgcacgtgaagtccttcttc
gactccaacggcgacggcatcggcgacttccccggcctgatctccaagctcgactacatc
gcctcgctcggcgtggacgcgctgtggctgctgcccttctatccctcgccgcgccgcgac
gacggctacgacatcgccgactaccgcaacgtccatcccgactacggcaccctggccgac
gtgcgccgcttcatccgcgaggcgcacgcgcgcggcatccgcgtgatcaccgagctggtg
atcaaccacacctcggaccagcatccctggttccagcgcgcgcgccgcgccaagcgcggc
tcggtgcatcgcgactactacgtgtggtccgataccgacaccaagttcgccggcacgcgc
gtgatcttcgtcgacagcgagccgtcgaactggacccacgacccggtcgccggccagtac
tactggcaccgcttctactcgcaccagccggacctcaacttcgacaatccggcggtggtg
cgcgaggtgctgcagatcatgcgcttctggctggacctgggcatcgacggcctgcgcctg
gacgcggtgccctacctggtcgagcgcgagggcaccagcaacgagaacctgcccgagacg
cacgcggtgctcaagcggatccgcgccgcgatcgacgccgaataccccaatcgcatgctg
ctggccgaggccaaccagtggcccgaggacgtgcaggagtacttcggccgcgaggacgaa
tgccacatggccttccacttcccgctgatgccgcgcatctacatgtcgatcgccagcgag
gaccgcttcccgatcatcgacatcatgcggcagacgccggagctcgcgcccagcaaccag
tgggcgatcttcctgcgcaaccacgacgagctgaccctggagatggtcaccgacgccgag
cgcgacatgctctggcaggcctacgcgagcgaccgccgcgcgcgcctgaacctcggcatc
cggcggcgcctcgcgccgctgatggagcgcgaccggcgccgcatcgagctgatcaactcg
ctgctgctgtcgatgccgggcacgccggtgatctactacggcgacgagctgggcatgggc
gacaacatccacctcggcgaccgcgacggcgtgcgcacgccgatgcagtggtcggccgac
cgcaatggcggcttctcgcgcgccgatcccgagcaactggtgctgccgcccgtgatgggc
gcgctgtacggcttcgacgcggtcaacgtcgaggcgcaatcgcgcgacccgcattcgctg
ctgaactggatgcgccggatcctggccacgcgccgcgccacccaggtgttcgggcgcggc
acgctgcgcttcctgcgccccgagaaccgcaaggtgctggcctacctgcgcgagctgccc
gacgcgacgcccgtgctgtgcgtggccaacctgtcgcgcgcctcgcaggcggtcgagctc
gacctctccgaattcgccggcagcgtgccggtggagatgacctccgattcgccgttcccg
gcgatcggcgagctgccctacctgctgacctttccgccctacggcttcctgtggttctcg
ctctcgccgaccggcgccgagccggcctggcaccgcccgcatgccgagccgctgcccgag
tacaccaccctggtgatgcggcgcggcgatgcacagccggccgcgccgctggtcgccacg
ctggaggccgaggtgctgccgcagtggctcacgcggcgccgctggttcgcctcgaaggac
cgctcgctggacgcggcacgcttcgactgcgtgacgccgattcccggcgagccgttccag
tacgccgaggtggtggccagctcggacggccgcgaggaacgctacgtggtgccgctggcc
gccgcctggggcgacgaaaccccgcatccgctgttcatgcggctggcgctggcgcgcgtg
cggcgcggcccgacggtcggctatttgaccgacgccttcgccttgcccggcttcgcgcac
ggcgtgctggccaagctggccgagcgcgccagcgtgcccctgaccagtggagggaccctg
gtgttctcgcccgagcccacgctcaccgaggtgatgcaggcactgggcccgacgcccggg
atccgctggctcgccgccgagcagagcaacagctcgctagtgatcggcgagaccctggtg
ctcaagctggtgcggcgggtggcggccggcatccatcccgaggccgagatgagccgtcac
ctgacgcgcgccggctacgccaacgcgccggcgctggccggcgaggtgctgcgcgtgggc
gccgacggcacgccacacacggtggcgatcgtgcaggccttcgtcgataaccagggcgac
gcctgggtccgctcgctcgacttcctcaagcgcgcggtgggtgacctggcgctgtcggcc
tcggccacgcccgacgcccaggaggccgacggcgaggccgacgagatcgacgcctatgcc
gagttcgccggcgcgatcggcacgcgcctgggcgagctgcacgtgacgctggccgcgccc
accgacgacccggccttcgcgcccgagcgcgccacgcccgcccacgtggcgcgctggacg
caggacgcgatcgcgatggtcgatcgcgcgatgagcctgctcgcgccgcgtctggacgac
ctcgacgacggcgtgcgcgatgccgcgctcgcgctgctggcctcgcgcgaggacctggtc
gcggcgctcgattcgctgctgccggaacacctcgacgcgatttgcacgcgtatccacggc
gatttccatctcggccaggtgctcgacgtgcatggcgacgcgatgctgatcgacttcgag
ggcgagccggcccgcgcgctggacgcacgccgcgcgaaatcgcatcccttgcgcgacgtg
gcgggcctgctgcgctcgctctcgtatgccagcgcggccgcgcagttctcgatcgagaag
gcgcccgcgcccaccgccgacctcaagcgcacgctgttcgaccgcttcgggcaggccgcc
gccgaccgcttcctcgccaactaccggcgcgccgtcgagctcgcgcccacgccgttcgcc
gggcccgccgacgccgagcgcctgctgatgctgttcctggtcgagaaggccgcctacgag
ctggcctacgaggccgccaaccggcccgactggctcagcgtgccggtgctcgggctggcc
gcgctcagcgcgcaactgctgggccgcgaccgcggcccggacgaggacgccccgtcctcc
gaatcccattcacccgacgagctcccgccggagaacccgcaatga

DBGET integrated database retrieval system